DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr77a and Gr33a

DIOPT Version :9

Sequence 1:NP_730560.1 Gene:Gr77a / 117476 FlyBaseID:FBgn0045474 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_525102.4 Gene:Gr33a / 34641 FlyBaseID:FBgn0032416 Length:475 Species:Drosophila melanogaster


Alignment Length:333 Identity:62/333 - (18%)
Similarity:111/333 - (33%) Gaps:102/333 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 EVRRNFMYACSLVFVSVCQAILQLSLGMYTMAILFLGHLVRH----------SNLLLAKILADAE 249
            :||..::...:|.|:.     ..:|...|....:..|..:.|          .|:||.||..:|.
  Fly   150 DVRSLYLTFGNLAFIP-----FMVSSFPYLAGSIIQGEFIYHVSVISQRFEQINMLLEKINQEAR 209

  Fly   250 H-------------------------IFESSQKAGF-----WPNRQELYKGQQK----------- 273
            |                         :.:.....||     :....:..:||||           
  Fly   210 HRHAPLTVFDIESEGKKERKTVTPITVMDGRTTTGFGNENKFAGEMKRQEGQQKNDDDDLDTSND 274

  Fly   274 -----------WLALELWRLLHVH-HQLLKLHRSICSLCAV------------QAVCFLGFVPLE 314
                       .:|.........: ..|.|||..|.:|..:            .|.||:      
  Fly   275 EDEDDFDYDNATIAENTGNTSEANLPDLFKLHDKILALSVITNGEFGPQCVPYMAACFV------ 333

  Fly   315 CTIHLFFTYFMKYSKFILRKYGRSFPLNYFAIAFLVGLFTNLLLVIL-------PTYYSERRFNC 372
              :.:|..:......||:.  |:|..|:|....:::..||.:::..:       ...:|::....
  Fly   334 --VSIFGIFLETKVNFIVG--GKSRLLDYMTYLYVIWSFTTMMVAYIVLRLCCNANNHSKQSAMI 394

  Fly   373 TREIIKGGGLAFPSRITVKQLRHT-MHFYGLYLKNVEHVFAVSACGLFKLNNAILFCIVGAILEY 436
            ..||::    ..|:.:....|.:. |..:.|...:.|..|..:..|||.|:...:|..|.|...|
  Fly   395 VHEIMQ----KKPAFMLSNDLFYNKMKSFTLQFLHWEGFFQFNGVGLFALDYTFIFSTVSAATSY 455

  Fly   437 LMILIQFD 444
            |::|:|||
  Fly   456 LIVLLQFD 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr77aNP_730560.1 7tm_7 37..444 CDD:285581 60/331 (18%)
Gr33aNP_525102.4 7tm_7 <289..465 CDD:303125 40/189 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.