DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr77a and Gr2a

DIOPT Version :9

Sequence 1:NP_730560.1 Gene:Gr77a / 117476 FlyBaseID:FBgn0045474 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001162633.1 Gene:Gr2a / 31093 FlyBaseID:FBgn0265139 Length:428 Species:Drosophila melanogaster


Alignment Length:487 Identity:101/487 - (20%)
Similarity:173/487 - (35%) Gaps:144/487 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PLALAVSPQLGYIRITAMPRWLQLPGMSALGILYSLTRVFGLMATANW-----SPRGIKRVRQSL 67
            |..||..|....| :....|||:|.|.:.|....|.| |:||...::.     |...|..:..::
  Fly    21 PWRLAPPPDSEGI-LLRRSRWLELYGWTVLIAATSFT-VYGLFQESSVEEKQDSESTISSIGHTV 83

  Fly    68 -YLRIHGCVMLIFVGCFSPFAFWCIFQRMA---FLRQ----NRIL----------LMIGFNRYVL 114
             ::::.|..:........  |.|   ||.|   |..:    :|:|          :.|...|...
  Fly    84 DFIQLVGMRVAHLAALLE--ALW---QRQAQRGFFAELGEIDRLLSKALRVDVEAMRINMRRQTS 143

  Fly   115 LLVCAFMTLWIHCFKQAEIIGC--LNR--------------LLKCRRRLRRLMH-TRKLKDSMDC 162
            ..  |...||.:...|..|:|.  |:|              ||.|..|..::.: |:.::..:|.
  Fly   144 RR--AVWILWGYAVSQLLILGAKLLSRGDRFPIYWISYLLPLLVCGLRYFQIFNATQLVRQRLDV 206

  Fly   163 LATKGHLLEVVVLLSSYLLSMAQP-----IQILKDDPEVRRNFMYACSLVF--VSVCQAILQLSL 220
            |         :|.|....|....|     ::..:|..|...:.:.|..||:  |....|:|....
  Fly   207 L---------LVALQQLQLHQKGPAVDTVLEEQEDLEEAAMDRLIAVRLVYQRVWALVALLNRCY 262

  Fly   221 GMYTMAILFLGHLVRHSNLLLAKILADAEHIFESSQKAGFWP-NRQELYKGQQKWLALELWRLLH 284
            |        |..|::..|..|| |.::...:|.:.:::...| :..::       :|..:|...|
  Fly   263 G--------LSMLMQVGNDFLA-ITSNCYWMFLNFRQSAASPFDILQI-------VASGVWSAPH 311

  Fly   285 VHHQLLKLHRSICSLCAVQAVCFLGFVPLECTIHLFFTYFMKYSKFILRKYGRSFPLNYFAIAFL 349
            :.:.|:     :..||...|.|                    .|:..|..:..|..|...:...|
  Fly   312 LGNVLV-----LSLLCDRTAQC--------------------ASRLALCLHQVSVDLRNESHNAL 351

  Fly   350 VGLFTNL---LLVILPTYYSERRFNCTREIIKGGGLAFPSRITVKQLRHTMHFYGLYLKNVEHVF 411
            ||.....   |::::|...::                    .:::.|...:||            
  Fly   352 VGTLVRYCAPLIILVPLQITQ--------------------FSLQLLHQRLHF------------ 384

  Fly   412 AVSACGLFKLNNAILFCIVGAILEYLMILIQF 443
              ||.|.|.::..:|:.||||...||:|||||
  Fly   385 --SAAGFFNVDCTLLYTIVGATTTYLIILIQF 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr77aNP_730560.1 7tm_7 37..444 CDD:285581 91/458 (20%)
Gr2aNP_001162633.1 7tm_7 7..418 CDD:285581 101/487 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.