DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr77a and Gr10a

DIOPT Version :9

Sequence 1:NP_730560.1 Gene:Gr77a / 117476 FlyBaseID:FBgn0045474 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster


Alignment Length:382 Identity:76/382 - (19%)
Similarity:125/382 - (32%) Gaps:133/382 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 PFAFWCIFQRMAFLRQNRILLMIG----FNRY------------VLLLVCAFMTLWIHCFKQAEI 133
            ||.|:..|:   |...| :::||.    |.:|            |...:.||: ||.:....|:.
  Fly   141 PFEFFMYFK---FCLIN-LMMMIQVCGIFAQYGEVGKGSVSQVRVHFAIYAFV-LWNYTENMADY 200

  Fly   134 IGCLN-RLLKCRRRLRRLMHTRKLKDSMDCLATKGHLLEVVVLLSSYLLSMAQPIQILKDDPEVR 197
            ...:| .:||..|:..  :....|:|.||.|...|.||.....||..|             .|:|
  Fly   201 CYFINGSVLKYYRQFN--LQLGSLRDEMDGLRPGGMLLHHCCELSDRL-------------EELR 250

  Fly   198 RNFMYACSLVFVSVCQAILQLSLGMYTMAILFLGHLVRHSNLLLAKILADAEHIFESSQKAGFWP 262
            |.            |:.|..|....:.|      |..:...|:|:.::.:..:.:.         
  Fly   251 RR------------CREIHDLQRESFRM------HQFQLIGLMLSTLINNLTNFYT--------- 288

  Fly   263 NRQELYKGQQKWLALELWRLLHVHHQLLKLHRSICSLCAVQAVCFLGFVPLECTIHLFFTYFMKY 327
                                  :.|.|.|.     ||..|.....:|.|                
  Fly   289 ----------------------LFHMLAKQ-----SLEEVSYPVVVGSV---------------- 310

  Fly   328 SKFILRKYGRSFPLNYFAIAFLVGLFTNLLLVILPTYYSERRFNCTREIIKGGGLAFPSRITVKQ 392
                   |...|.::.:.:|.   :..::.|.:.....:.|||...||:        ..|:| ::
  Fly   311 -------YATGFYIDTYIVAL---INEHIKLELEAVALTMRRFAEPREM--------DERLT-RE 356

  Fly   393 LRHTMHFYGLYLKNVEHVFAVSACGLFKLNNAILFCIVGAILEYLMILIQFDKVLNK 449
            :.|    ..|.|.|.:   ....|||..|:..:::.|......|.:.|:|||..|.|
  Fly   357 IEH----LSLELLNYQ---PPMLCGLLHLDRRLVYLIAVTAFSYFITLVQFDLYLRK 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr77aNP_730560.1 7tm_7 37..444 CDD:285581 72/375 (19%)
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 73/376 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.