DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr77a and Gr22e

DIOPT Version :9

Sequence 1:NP_730560.1 Gene:Gr77a / 117476 FlyBaseID:FBgn0045474 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_722731.1 Gene:Gr22e / 117498 FlyBaseID:FBgn0045497 Length:389 Species:Drosophila melanogaster


Alignment Length:444 Identity:96/444 - (21%)
Similarity:175/444 - (39%) Gaps:96/444 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RWLQLPGMSALGILYSLTRVFGLMATA--NWSPRGIKRVRQSLYLRIHGCVM-----LIFV---- 80
            :|   .|::..|.||. :.:.|:...|  :|:    :.:|:|.:|..:|.|:     |:.|    
  Fly    12 KW---TGLTLKGALYG-SWILGVFPFAYDSWT----RTLRRSKWLIAYGFVLNAAFILLVVTNDT 68

  Fly    81 GCFSPFAFWCIFQRMAFLRQ-NRILLMIGFNRYVLLLVCAFMTLWIHCFKQAEIIGCLNRLLKCR 144
            ...:|.... :|.|.|...| |.|..:...:...::|:.:|   |    |..:|...||.|...:
  Fly    69 ESETPLRME-VFHRNALAEQINGIHDIQSLSMVSIMLLRSF---W----KSGDIERTLNELEDLQ 125

  Fly   145 RRLRRLMHTRKLKDSMDCLATKGHLL-----EVVVLLSSYLLSMAQPIQILKDDPEVRRNFMYAC 204
            .|..|.....      :|::....:|     .|:.|:|..:|.:..       .|.....|....
  Fly   126 HRYFRNYSLE------ECISFDRFVLYKGFSVVLELVSMLVLELGM-------SPNYSAQFFIGL 177

  Fly   205 SLVFVSVCQAILQLSLGM--YTMAILFLGH---LVRHSNLLLAKILADAEHIFESSQKAGFWPNR 264
            .    |:|..:|.:.||.  :.:|::|:..   :|....|.|...:|..|.: ||        .|
  Fly   178 G----SLCLMLLAVLLGASHFHLAVVFVYRYVWIVNRELLKLVNKMAIGETV-ES--------ER 229

  Fly   265 QELYKGQQKWLALELWRLLHVHHQLLKLHRSICSLCAVQAVCFLGFVPLECTIHLFFTYFMKYSK 329
            .:|              ||:::|:||.|.:.:.|:...|.|..:....:...:.::|        
  Fly   230 MDL--------------LLYLYHRLLDLGQRLASIYDYQMVMVMVSFLIANVLGIYF-------- 272

  Fly   330 FILRKYGRSFPLNYFAIAFLVGLFTNLL---LVILPTYYSERRFNCTREIIKGGGLAFPSRITV- 390
            ||:.....:..|::..:.|:..|..|:|   |.:.....:||....|..|:|    .|.....: 
  Fly   273 FIIYSISLNKSLDFKILVFVQALVINMLDFWLNVEICELAERTGRQTSTILK----LFNDIENID 333

  Fly   391 KQLRHTMHFYGLYLKNVEHVFAVSACGLFKLNNAILFCIVGAILEYLMILIQFD 444
            ::|..::..:.|:..:....|  ..||||.:|..:.|.:......||:.|||||
  Fly   334 EKLERSITDFALFCSHRRLRF--HHCGLFYVNYEMGFRMAITSFLYLLFLIQFD 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr77aNP_730560.1 7tm_7 37..444 CDD:285581 92/432 (21%)
Gr22eNP_722731.1 7tm_7 18..388 CDD:285581 94/435 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.