DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr77a and Gr36b

DIOPT Version :9

Sequence 1:NP_730560.1 Gene:Gr77a / 117476 FlyBaseID:FBgn0045474 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster


Alignment Length:417 Identity:80/417 - (19%)
Similarity:160/417 - (38%) Gaps:91/417 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 IFVGCF----SPFAFWCIFQRM---------AFLRQNRILLMIGFN------------------R 111
            :.:.|:    |.|.|.|...|:         ||:....||:.|.:|                  .
  Fly    12 VHIYCYLIGLSNFEFDCRTGRVFKSRRCTIYAFMANIFILITIIYNFTAHGDTNLLFQSANKLHE 76

  Fly   112 YVLLLVCAFMTLWIHCFKQAEIIGCLNRLLKCRRRLRRLMHTRKLKDSMDCLATKGHLLEVV--- 173
            ||::::.....:       |.:|..|||.|: |.::.:|     :||.:........|..::   
  Fly    77 YVIIIMSGLKIV-------AGLITVLNRWLQ-RGQMMQL-----VKDVIRLYMINPQLKSMIRWG 128

  Fly   174 VLLSSYLLSMAQPIQILKDDPEVRRNFMYACSLVFVSVCQA-ILQLSLGMYTMAILFLGHLVRHS 237
            :||.:::....:.:|:......:.|........:.|.:|.: |:.|::..:.:.||.:....|..
  Fly   129 ILLKAFISFAIELLQVTLSVDALDRQGTAEMMGLLVKLCVSFIMNLAISQHFLVILLIRAQYRIM 193

  Fly   238 NLLLAKILADAEHIFESSQKAGFWPNRQELYKGQQKWLALELWRLLHVHHQLLKLHRSICSLCAV 302
            |..|..::       |.|::..|...|...:..:..:|:.:|..:..|..||..:...:..:..:
  Fly   194 NAKLRMVI-------EESRRLSFLQLRNGAFMTRCCYLSDQLEDIGEVQSQLQSMVGQLDEVFGM 251

  Fly   303 QAVCFLGFVPLECTIHLFFTYFMKYSKFILRKYGRSFPLNYFAIAFLVGLFTNLLLVILPT-YYS 366
            |.:....    |..:.:..|.:|.||   :.|||   |.|     ..:...|::::.||.| :|.
  Fly   252 QGLMAYS----EYYLSIVGTSYMSYS---IYKYG---PHN-----LKLSAKTSIIVCILITLFYL 301

  Fly   367 ERRFNCT---------REIIKGGGL-----AFPSRITVKQLRHTMHFYGLYLKNVEHVFAVSACG 417
            :...||.         ::.:   ||     .|.|.:   .:|....|..|.|:...:...::..|
  Fly   302 DALVNCNNMLRVLDHHKDFL---GLLEERTVFASSL---DIRLEESFESLQLQLARNPLKINVMG 360

  Fly   418 LFKLNNAILFCIVGAILEYLMILIQFD 444
            :|.:.......:..:::...:.|||||
  Fly   361 MFPITRGSTAAMCASVIVNSIFLIQFD 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr77aNP_730560.1 7tm_7 37..444 CDD:285581 78/415 (19%)
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 80/417 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.