DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr77a and Gr36c

DIOPT Version :9

Sequence 1:NP_730560.1 Gene:Gr77a / 117476 FlyBaseID:FBgn0045474 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_724040.1 Gene:Gr36c / 117486 FlyBaseID:FBgn0045485 Length:390 Species:Drosophila melanogaster


Alignment Length:441 Identity:81/441 - (18%)
Similarity:160/441 - (36%) Gaps:102/441 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GMSALGILYSLTRVFGLMATANWSPRGIKRVRQSLY-LRIHGCVMLIFVGCFSPFAFW------- 89
            |:|.....::..|||    |..||         :|| :.:..|:..:::      ..|       
  Fly    19 GLSNFEFDWNTGRVF----TKKWS---------TLYAIALDSCIFALYI------YHWTGNTNIV 64

  Fly    90 -CIFQRMAFLRQNRILLMIGFNRYVLLLVCAFMTL---WIHCFKQAEIIGCLNRLLKCRRRLRRL 150
             .||.|...|.:..:.::.|     |.:|....||   |....|..::...:.|:...|.::||:
  Fly    65 NAIFGRANMLHEYVVAILTG-----LRIVTGLFTLILRWYQRCKMMDLASKVVRMYVARPQVRRM 124

  Fly   151 MHTRKLKDSMDCLATKGHLLEVVVLLSSYLLSMAQPIQILKDDPEVRRNFMYACSL---VFVSVC 212
            .....|...:....|.|  |::.::||:.              ..|...|.....|   :||   
  Fly   125 SRWGILTKFIFGSITDG--LQMAMVLSAM--------------GSVDSQFYLGLGLQYWMFV--- 170

  Fly   213 QAILQLSLGMYTMAILFLGHLVRHSNLLLAKILADAEHIFESSQKAGFWPNRQELYKGQQKWLAL 277
              ||.:::....|.:||:....:..|..|.:::.:|:.:..|       |..|.::..:...||.
  Fly   171 --ILNMAMMQQHMIMLFVRTQFQLINTELRQVIDEAKDLLLS-------PRHQGVFMTKCCSLAD 226

  Fly   278 ELWRLLHVHHQLLKLHRSICSLCAVQ-------------AVCFLGFVPLECTIHLFFTYFMKYSK 329
            ::..:..:..||..:...:..:..:|             ..|:|.:..|:   |.:....|..|.
  Fly   227 QIENIARIQSQLQTIMNQMEEVFGIQGAMTYGGYYLSSVGTCYLAYSILK---HGYENLSMTLST 288

  Fly   330 FILRKYGRSFPLNYFAIAFLVGLFT-NLLLVILPTYYSERRFNCTREIIKGGGLAFPSRITVKQL 393
            .|| .|...|      ..:|.|:.. :::|.:...|:...:....|.|..|           ..:
  Fly   289 VIL-AYSWCF------FYYLDGMLNLSVMLHVQDDYWEMLQILGKRTIFVG-----------LDV 335

  Fly   394 RHTMHFYGLYLKNVEHVFAVSACGLFKLNNAILFCIVGAILEYLMILIQFD 444
            |....|..|.|:.:.:...::...|:.:..:....:.|.::.:.:.|||:|
  Fly   336 RLEEAFENLNLQLIRNPLKITVVKLYDVTRSNTMAMFGNLITHSIFLIQYD 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr77aNP_730560.1 7tm_7 37..444 CDD:285581 78/435 (18%)
Gr36cNP_724040.1 7tm_7 8..389 CDD:285581 81/441 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.