DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr77a and Gr59b

DIOPT Version :9

Sequence 1:NP_730560.1 Gene:Gr77a / 117476 FlyBaseID:FBgn0045474 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_523818.2 Gene:Gr59b / 117484 FlyBaseID:FBgn0045482 Length:366 Species:Drosophila melanogaster


Alignment Length:413 Identity:82/413 - (19%)
Similarity:151/413 - (36%) Gaps:106/413 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 SLYLRIHGCVMLIFVGCFSPFAFW---CIFQR-----MAFLRQNRILLMIGFNRYVLLLVCAFMT 122
            :|:.|.:..:..|......|...|   .:||:     ...|..|.:...:.|  .|:|.......
  Fly    31 TLFSRTYALIANIVTLIMLPIVMWQVQLVFQQKKTFPKLILITNNVREAVSF--LVILYTVLSRG 93

  Fly   123 LWIHCFKQAE--IIGCLNRLLKC--------RRRLRRLMHTRKLKDSMDCLATKGHLLEVVVLLS 177
            .....||:.:  ::.......:|        ||.||.|:..:....|..|:.      :|:.|| 
  Fly    94 FRDTAFKEMQPLLLTLFREEKRCGFKGIGGVRRSLRILLFVKFFTLSWLCVT------DVLFLL- 151

  Fly   178 SYLLSMAQPIQILKDDPEVRRNFMYACSLVFVSVCQAILQL-SLGMYTMAILFLGHLVRHSNLLL 241
             |.......:.:|:        |.:.|:      ...||:: .:|.:    |.|.|:.|..:.:.
  Fly   152 -YSTDALIWVNVLR--------FFFKCN------TNNILEMVPMGYF----LALWHIARGFDCVN 197

  Fly   242 AKILADAEHIFESSQKAGFWPNRQELYKGQQKWLALELWRLLHVHHQLLKLHRSICSLCAVQAVC 306
            .::    :.|.:|....    ..:||   |..||         :|..|.|...:|..:.|.|.:.
  Fly   198 RRL----DQIVKSKSTR----KHREL---QHLWL---------LHACLTKTALNINKIYAPQMLA 242

  Fly   307 --FLGFV--PLECTIHLFFTYFMKYSKFILRKYGRSFPLNYFAIAFLVGLFTNLLLVILPTY--- 364
              |..||  .::......||:.:. :.|....||   .:.|........|..|:..|.:..:   
  Fly   243 SRFDNFVNGVIQAYWGAVFTFDLS-TPFFWVVYG---SVQYHVRCLDYYLIDNMCDVAVEYHDSA 303

  Fly   365 ---YSERRFNCTREIIKGGGLAFPSRITVKQLRHTMHFYGLYLKNVEHVFAVSACGLFKLNNAIL 426
               :||.|:  |:||..                     |.:|..:.:  ..:.:||||:.|.::.
  Fly   304 KHSWSEVRW--TKEISS---------------------YVIYANSTK--LQLWSCGLFQANRSMW 343

  Fly   427 FCIVGAILEYLMILIQFDKVLNK 449
            |.::.::|.|:::|:||..|:.|
  Fly   344 FAMISSVLYYILVLLQFHLVMRK 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr77aNP_730560.1 7tm_7 37..444 CDD:285581 79/406 (19%)
Gr59bNP_523818.2 7tm_7 6..364 CDD:285581 80/409 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.