DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr77a and Gr98c

DIOPT Version :9

Sequence 1:NP_730560.1 Gene:Gr77a / 117476 FlyBaseID:FBgn0045474 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_524531.2 Gene:Gr98c / 117336 FlyBaseID:FBgn0046886 Length:408 Species:Drosophila melanogaster


Alignment Length:452 Identity:88/452 - (19%)
Similarity:165/452 - (36%) Gaps:154/452 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 YLRIHGCVMLIFVGCFSPFAFWCIFQRMAFLRQNRILLMIGFNRY---VLLLV-----CAFMTLW 124
            ||::     |...|...|..|   |.| ...::.|...|.|::.|   :||:|     ...::|.
  Fly    17 YLQV-----LSLFGLTPPAEF---FTR-TLRKRRRFCWMAGYSLYLIAILLMVFYEFHANIVSLH 72

  Fly   125 IHCFK-----QAEIIGCLNRLL-----KCRRRLRRLMHTRKLKDSMDCLAT-------------- 165
            :..:|     .::::|...:.|     .| .:|..|::..:|....|.:|.              
  Fly    73 LEIYKFHVEDFSKVMGRTQKFLIVAIATC-NQLNILLNYGRLGLIYDEIANLDLGIDKSSKNFCG 136

  Fly   166 KGH---------------LLEVVVLLSSYLLSMAQPIQILKDDPEVRRNFMYACSLVFVSVCQAI 215
            |.|               ::.::.::....|..|.|             |.:..:.|...:...:
  Fly   137 KSHWWSFRLRLTLSIGLWMVIIIGVIPRLTLGRAGP-------------FFHWVNQVLTQIILIM 188

  Fly   216 LQLSLGMYTMAILFLGHLVRHSNLLLAKILADAEHIFESSQKAGFWPNRQEL--YKGQQKWLALE 278
            |||....|.:.:|.:..|:..:..:|.::..|.|. |:...:.      |||  ...|.:.|...
  Fly   189 LQLKGPEYCLFVLLVYELILRTRHVLEQLKDDLED-FDCGARI------QELCVTLKQNQLLIGR 246

  Fly   279 LWR--------------LLHVHHQLLKLH-------RSI-----CSLCAVQAVCFLGFVPLECTI 317
            :||              ||.:::.|..||       |||     |.|..:.::.||.|       
  Fly   247 IWRLVDEIGAYFRWSMTLLFLYNGLTILHVVNWAIIRSIDPNDCCQLNRLGSITFLSF------- 304

  Fly   318 HLFFTYFMKYSKFILRKYGRSFPLNYFAIAFLVGLFTNLLLVILPTYYSERRFNCTREIIKGGGL 382
            :|..|.|  :|:..::.|.   .::|  |...:|        .|||   ...|    :::|.|  
  Fly   305 NLLLTCF--FSECCVKTYN---SISY--ILHQIG--------CLPT---AEEF----QMLKMG-- 345

  Fly   383 AFPSRITVKQLRHTMHFYGLYLKNVEHVFAVSAC-GLFKLNNAILFCIVGAILEYLMILIQF 443
                   :|:          |:..::|:..:..| |||.:|..:...::..:..|::|::||
  Fly   346 -------LKE----------YILQMQHLKLLFTCGGLFDINIKLFGGMLVTLCGYVIIIVQF 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr77aNP_730560.1 7tm_7 37..444 CDD:285581 88/452 (19%)
Gr98cNP_524531.2 7tm_7 15..393 CDD:285581 88/452 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.