DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr92a and Gr98a

DIOPT Version :9

Sequence 1:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_651564.1 Gene:Gr98a / 43305 FlyBaseID:FBgn0039520 Length:391 Species:Drosophila melanogaster


Alignment Length:253 Identity:57/253 - (22%)
Similarity:100/253 - (39%) Gaps:72/253 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 YLWFTIRKGFS--WRFLIDWWCDF-YLVSATNIFIHINSIGYLSLG-------VLYSELNKYVYT 211
            |:...:..|||  |||..|:..|: :|....:..|.:::...|.||       :|:...:|.|..
  Fly    39 YVLLFVSLGFSSYWRFSFDYEFDYDFLNDRFSSTIDLSNFVALVLGHAIIVLELLWGNCSKDVDR 103

  Fly   212 NL-----RIQLQKLNTSGSKQKIRRVQN------RLEKCISLYREIY-HTSIMFHKLFVPLLFLA 264
            .|     :|:|| |.||.|..::||..|      .:...|.:...|| :.::..:..:..|:|||
  Fly   104 QLQAIHSQIKLQ-LGTSNSTDRVRRYCNWIYGSLIIRWLIFIVVTIYSNRALTINATYSELVFLA 167

  Fly   265 -------------LIYKVLLIALIGFNVAVEFYLNSFIFWILLGKHVLDLFLVTVSVEGAVNQFL 316
                         .||:.|::.  |.||..|.|...:..|                      ...
  Fly   168 RFSEFTLYCAVILFIYQELIVG--GSNVLDELYRTRYEMW----------------------SIR 208

  Fly   317 NIGMQFGNVGDLSKFQTTLDTLFLHLRL--GHFRVSILGL-----FDVTQMQYLQFLS 367
            .:.:|     .|:|.|...::|:..:|.  .:|::|::.|     .|.:.:.|..:||
  Fly   209 RLSLQ-----KLAKLQAIHNSLWQAIRCLECYFQLSLITLLMKFFIDTSALPYWLYLS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 57/253 (23%)
Gr98aNP_651564.1 7tm_7 13..370 CDD:285581 57/253 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.