DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr92a and Gr59f

DIOPT Version :9

Sequence 1:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster


Alignment Length:355 Identity:69/355 - (19%)
Similarity:122/355 - (34%) Gaps:124/355 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 APKLSTSIL----------------RYIFRYAQFIGVIFFCLHTRKDDKTVFIRNWLKWLNVTHR 58
            ||||.|:|:                |:| |...|:..||.||       .:|...|      ||:
  Fly   126 APKLMTNIVTSDLNRAYTIDCNRTKRFI-RLQLFLVGIFACL-------AIFFNIW------THK 176

  Fly    59 IITFTRFFWVYIASISIKTNRVLQVLHGMRLVLSIPNVAVILCYHIFRGPEIIDLIN--QFLRLF 121
            .:.:                         |.:|||.:..:         |.||..|:  |:..|.
  Fly   177 FVVY-------------------------RSILSINSYVM---------PNIISSISFAQYYLLL 207

  Fly   122 RQVSDLFKTKTPGFGGRRELILILLNLISFA-----HEQTYLWFT--IRKGFSWRFL---IDWWC 176
            :.::...:..|.|.  .|||..:....||..     |....:.||  :.:.|.:..|   :..:.
  Fly   208 QGIAWRQRRLTEGL--ERELTHLHSPRISEVQKIRMHHANLIDFTKAVNRTFQYSILLLFVGCFL 270

  Fly   177 DFYLVSATNIFIHINSIGYLSLGVLYSELNKYVYTNLRIQLQKLNTSGSKQKIRRVQNRLEKCIS 241
            :|.||    :|:....|...|:    ::..|:|...|.:.:............:.:||....|::
  Fly   271 NFNLV----LFLVYQGIENPSM----ADFTKWVCMLLWLAMHVGKVCSILHFNQSIQNEHSTCLT 327

  Fly   242 LYREIYH-----------------TSIMFH----KLFVPLLFLALIYKVLLIALIGFNVAVEFYL 285
            |...:.:                 |::..|    .:.:.|.||.    .||:|            
  Fly   328 LLSRVSYARKDIQDTITHFIIQMRTNVRQHVVCGVINLDLKFLT----TLLVA------------ 376

  Fly   286 NSFIFWILLGKHVLDLFLVTVSVEGAVNQF 315
             |..|:|.|.::.:....::.||:|.|.::
  Fly   377 -SADFFIFLLQYDVTYEALSKSVQGNVTRY 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 63/347 (18%)
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 65/336 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.