DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr92a and Gr57a

DIOPT Version :9

Sequence 1:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster


Alignment Length:433 Identity:86/433 - (19%)
Similarity:157/433 - (36%) Gaps:137/433 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IGVIFFCLHTRKDDKTVF-------IRNWLKWLN-VTHRIITFTRFFW---VYIASISIK----- 76
            :.|::|.    ::.:|||       |..:|...| ...|..|| |..|   :|..|::|.     
  Fly     1 MAVLYFF----REPETVFDCAAFICILQFLMGCNGFGIRRSTF-RISWASRIYSMSVAIAAFCCL 60

  Fly    77 --TNRVLQVLHGMR--------LVLSIPNVAVILCYHIFRGPEIIDL---INQFLRLFRQVSDLF 128
              :..||.....:|        |||||..:.:::...:| |..:|.|   ..:.|.::::::.|.
  Fly    61 FGSLSVLLAEEDIRERLAKADNLVLSISALELLMSTLVF-GVTVISLQVFARRHLGIYQRLAALD 124

  Fly   129 KTKTPGFGGR-------RELILIL-------LNLISFAHEQTYLWFTIRKGFSWRFLIDWWCDFY 179
            ......||..       |:.|.:|       |..|:.|..|      :..|....||:...|...
  Fly   125 ARLMSDFGANLNYRKMLRKNIAVLGIVTTIYLMAINSAAVQ------VASGHRALFLLFALCYTI 183

  Fly   180 LVSATNI--FIHINSIGYLSLGV-LYSELNKYVYTNLR---IQLQKLNTSGSKQKIRRVQNRLEK 238
            :....:.  ::|:.....|.:.. |..:|.:..:.|.|   :.:|:|       :||:|.:.:::
  Fly   184 VTGGPHFTGYVHMTLAEMLGIRFRLLQQLLQPEFLNWRFPQLHVQEL-------RIRQVVSMIQE 241

  Fly   239 CISLYREI---YHTSI---MFHKL---------------------------------FVPLLFLA 264
            ...|.:||   |..|:   |.|.|                                 ::.|:.:.
  Fly   242 LHYLIQEINRVYALSLWAAMAHDLAMSTSELYILFGQSVGIGQQNEEENGSCYRMLGYLALVMIP 306

  Fly   265 LIYKVLLIALIGFNVAVEFYLNSFIF----WILLGKHVLDLFLVTVSVEGAVNQFLNIGMQFGNV 325
            .:||:|:         ..||.:..|:    .:.|.:.:.|.|....|:...|...::..:|    
  Fly   307 PLYKLLI---------APFYCDRTIYEARRCLRLVEKLDDWFPQKSSLRPLVESLMSWRIQ---- 358

  Fly   326 GDLSKFQTT--LDTLFLHLRLGHFRVSILGLFDVTQMQYLQFL 366
               :|.|.|  ||.:...        .::|||....:.||..|
  Fly   359 ---AKIQFTSGLDVVLSR--------KVIGLFTSILVNYLLIL 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 86/433 (20%)
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 78/398 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.