DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr92a and Gr9a

DIOPT Version :9

Sequence 1:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster


Alignment Length:340 Identity:60/340 - (17%)
Similarity:125/340 - (36%) Gaps:103/340 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 RLFRQVSDLFKTKTPGFGGRRELILILLNL----------------------------ISFAHEQ 155
            ||.|.:|..|            |:|||:.|                            ::.|::.
  Fly    26 RLGRLLSSTF------------LVLILIELVGEIETYFTEENPDNESVPAYFAKVIMGVNMAYKM 78

  Fly   156 TYLWFTIRKGFS---WRFLIDWWCDFYLVSATNIFIHINSIGYLSLGVLYSELNKYV----YTNL 213
            .:.|..:...|.   :|:|::   :...|.||: ||:    .:|.|.::....|.::    ||..
  Fly    79 IHAWIALSALFECRRFRYLLE---ELPPVKATS-FIY----RHLILEIILFACNAFLVLSEYTIR 135

  Fly   214 RIQLQKLNTSGSKQKIR-----------RVQNRLEKCISLYREIYHTSIMFHKLFVPLLFLA--- 264
            .|.|:.|..:.|.|.:|           |:..:||:   |:..:...|..:..|.:....||   
  Fly   136 GIYLENLRYAYSLQAVRARYLQMMVLVDRLDGKLEQ---LHHRVISGSSDYKTLRLDYAHLAKVT 197

  Fly   265 -----------LIYKVL------LIALIGFNVAVEFYLNSFIFWILLGK-------HVLDLFLVT 305
                       |:..||      ::..:.|.||....|.:.:|  |.|:       .::.::.:.
  Fly   198 RSLSHLFGLSLLLLNVLCLGDWIIVCNVYFMVAYLQVLPATLF--LFGQVMFVVCPTLIKIWSIC 260

  Fly   306 VSVEGAVNQFLNIGMQFGNV-GDLSKFQTTLDTLFLHLRLGHFRVSILGLFDVTQM----QYLQF 365
            .:....|::..::..|..:: |.....::.::...|.:.....::.:.|::.:...    .:...
  Fly   261 AASHRCVSKSKHLQQQLKDLPGQTPVERSQIEGFALQIMQDPIQIDVCGIYHLNLQTLAGMFFFI 325

  Fly   366 LSALLSGLAFIAQYR 380
            |.||:..|.|::..|
  Fly   326 LEALVIFLQFVSLVR 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 60/340 (18%)
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 58/333 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.