DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr92a and lite-1

DIOPT Version :9

Sequence 1:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_509043.3 Gene:lite-1 / 180894 WormBaseID:WBGene00001803 Length:439 Species:Caenorhabditis elegans


Alignment Length:311 Identity:58/311 - (18%)
Similarity:115/311 - (36%) Gaps:73/311 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 LRLFRQVSDLFKTKTPGFGGRRELIL-----ILLNLISFAHEQTYLWFTIRKGFSWRFLIDWWCD 177
            |::..|.|...:||.   ..||:.::     :...|::.....||..      ..|.:::     
 Worm   145 LKILCQFSLNVRTKQ---AERRQFMINTFLAVFSGLLALTMAATYAM------SKWGYIL----- 195

  Fly   178 FYLVSATN-----IF--------IHINSIGYLSLGVLYSELNKYVYTNLRIQLQKLNTS------ 223
             |:|...|     ||        :.::.....:|.:|:.:....:..:::..:.::..:      
 Worm   196 -YIVGTPNLDTETIFCVLLDSYALFVSRAAISALAILFYQHCSVIRRSIKHLINEMVPAEQDECP 259

  Fly   224 ---GSKQKIRRVQNRLEKCISLYR--------EIYHTSIMFHKLFVPL-LFLALIYKVLLIALIG 276
               .|.|||...|      ||..|        |.|::.::|:...|.: :|..|::..:....|.
 Worm   260 LPESSLQKIHDCQ------ISYQRIFNGKAVIEEYYSFVLFYSYGVCIPIFCFLMFVGMSAQSIC 318

  Fly   277 FNVAVEFYLNSFIFWILLGKHVLDLFLV---TVSVEG---AVNQFLNIGMQFGNVGDLSKF-QTT 334
            ::..|     |.:.||:....||.||.:   .::.:|   ..:.|......|....||:.. |.|
 Worm   319 WSEVV-----SIVIWIVNAILVLLLFSLPAFMINEDGDRLVASSFRMYHETFHEERDLTVLSQMT 378

  Fly   335 LDTLFLHLRLGHFRVSILGLFDVTQMQYLQFLSALLSGLAFIAQYRMQVGN 385
            ..|..:|..  ...:|....|.:.:...|...||:|:  .|:..:...:.|
 Worm   379 FFTFQIHST--KLTLSACNYFYMDRSILLSLFSAILT--YFLILWEFDIKN 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 57/306 (19%)
lite-1NP_509043.3 7tm_7 75..425 CDD:285581 57/309 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.