DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr92a and Gr22e

DIOPT Version :9

Sequence 1:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_722731.1 Gene:Gr22e / 117498 FlyBaseID:FBgn0045497 Length:389 Species:Drosophila melanogaster


Alignment Length:434 Identity:89/434 - (20%)
Similarity:158/434 - (36%) Gaps:134/434 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFEFLHQMSAPKLSTSILRYIFRYAQFIGVIFFCLHTRKDDKTVFIRNWLKWLNVTHRIITFTRF 65
            :|.|.:......|..|  :::..|...:...|..|....|.::   ...|: :.|.||       
  Fly    30 VFPFAYDSWTRTLRRS--KWLIAYGFVLNAAFILLVVTNDTES---ETPLR-MEVFHR------- 81

  Fly    66 FWVYIASISIKTNRVLQVLHGMRLVLSIPNVAVILCYHIFRGPEIIDLINQF----LRLFRQVSD 126
                        |.:.:.::|:..:.|:..|:::|....::..:|...:|:.    .|.||..| 
  Fly    82 ------------NALAEQINGIHDIQSLSMVSIMLLRSFWKSGDIERTLNELEDLQHRYFRNYS- 133

  Fly   127 LFKTKTPGFGGRRELILILLNLISFAHEQTYLWFTIRKGFSWRFLIDWWCDFYLVS--------- 182
                              |...|||..      |.:.||||  .:::      |||         
  Fly   134 ------------------LEECISFDR------FVLYKGFS--VVLE------LVSMLVLELGMS 166

  Fly   183 ---ATNIFIHINSIGYLSLGVLYSE---------LNKYVYTNLRIQLQKLNTSGSKQKIRRVQNR 235
               :...||.:.|:..:.|.||...         :.:||:...|..|:.:|.....:.:.  ..|
  Fly   167 PNYSAQFFIGLGSLCLMLLAVLLGASHFHLAVVFVYRYVWIVNRELLKLVNKMAIGETVE--SER 229

  Fly   236 LEKCISLYREIYHTSIMFHKLFVPLLFLALIYKV-LLIALIGFNVA----VEFYLNSFIFWILLG 295
            ::..:.||          |:|......||.||.. :::.::.|.:|    :.|::   |:.|.|.
  Fly   230 MDLLLYLY----------HRLLDLGQRLASIYDYQMVMVMVSFLIANVLGIYFFI---IYSISLN 281

  Fly   296 KHVLDLFLVTVSVEGAV----NQFLNI---------GMQFGNV----GDLSKFQTTLD------T 337
            |. || |.:.|.|:..|    :.:||:         |.|...:    .|:......|:      .
  Fly   282 KS-LD-FKILVFVQALVINMLDFWLNVEICELAERTGRQTSTILKLFNDIENIDEKLERSITDFA 344

  Fly   338 LFL-HLRLGHFRVSILGLFDVT-QMQYLQFLSALLSGLAFIAQY 379
            ||. |.||   |....|||.|. :|.:...:::.|. |.|:.|:
  Fly   345 LFCSHRRL---RFHHCGLFYVNYEMGFRMAITSFLY-LLFLIQF 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 85/417 (20%)
Gr22eNP_722731.1 7tm_7 18..388 CDD:285581 89/434 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.