DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr92a and Gr36b

DIOPT Version :9

Sequence 1:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster


Alignment Length:436 Identity:75/436 - (17%)
Similarity:168/436 - (38%) Gaps:124/436 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ILRYIFRYAQFIGVIFFCLHTRKDDKTVFIRNWLKWLNVTHRIITFTR-FFWVYIASISI----- 75
            :|:.:..|...||:..|....|                 |.|:....| ..:.::|:|.|     
  Fly     8 LLKAVHIYCYLIGLSNFEFDCR-----------------TGRVFKSRRCTIYAFMANIFILITII 55

  Fly    76 -------KTNRVLQ-----------VLHGMRLVLSIPNVAVILCYHIFRGPEIIDLINQFLRLFR 122
                   .||.:.|           ::.|:::|..:   ..:|...:.|| :::.|:...:||:.
  Fly    56 YNFTAHGDTNLLFQSANKLHEYVIIIMSGLKIVAGL---ITVLNRWLQRG-QMMQLVKDVIRLYM 116

  Fly   123 ---QVSDLFKTKTPGFGGRRELILILLNLISFAHEQTYLWFTI----RKGFSWRF-LIDWWCDFY 179
               |:..:.:     :|      ::|...||||.|...:..::    |:|.:... |:...|..:
  Fly   117 INPQLKSMIR-----WG------ILLKAFISFAIELLQVTLSVDALDRQGTAEMMGLLVKLCVSF 170

  Fly   180 LVSATNIFIHINSIGYLSLGVLY----SELNKYVYTNLRIQLQKLNT----------SGSKQKIR 230
            ::   |:.|..:.:..|.:...|    ::|...:..:.|:...:|..          |...:.|.
  Fly   171 IM---NLAISQHFLVILLIRAQYRIMNAKLRMVIEESRRLSFLQLRNGAFMTRCCYLSDQLEDIG 232

  Fly   231 RVQNRLEKCISLYREIYHTSIMFHKLFVPLLFLALIYKVLLIALIGFNVAVEFYLNSFIFWILLG 295
            .||::|:..:....|::....:            :.|....::::|.:     |::..|:  ..|
  Fly   233 EVQSQLQSMVGQLDEVFGMQGL------------MAYSEYYLSIVGTS-----YMSYSIY--KYG 278

  Fly   296 KHVLDL---------FLVTV-SVEGAVN-----QFLNIGMQF-GNVGDLSKFQTTLD-------- 336
            .|.|.|         .|:|: .::..||     :.|:....| |.:.:.:.|.::||        
  Fly   279 PHNLKLSAKTSIIVCILITLFYLDALVNCNNMLRVLDHHKDFLGLLEERTVFASSLDIRLEESFE 343

  Fly   337 TLFLHLRLGHFRVSILGLFDVTQMQYLQFLSALLSGLAFIAQYRMQ 382
            :|.|.|.....:::::|:|.:|:.......::::....|:.|:.|:
  Fly   344 SLQLQLARNPLKINVMGMFPITRGSTAAMCASVIVNSIFLIQFDME 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 74/433 (17%)
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 75/435 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.