DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr92a and Gr36c

DIOPT Version :9

Sequence 1:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_724040.1 Gene:Gr36c / 117486 FlyBaseID:FBgn0045485 Length:390 Species:Drosophila melanogaster


Alignment Length:445 Identity:76/445 - (17%)
Similarity:169/445 - (37%) Gaps:134/445 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LSTSILRYIFRYAQFIGVIFFCLHTRKDDKT--VFIRNWLKWLNVTHRIITFTRFFWVYIASISI 75
            |.:.:|..::.|..|||:..|    ..|..|  ||.:.|    :..:.|...:..|.:||...:.
  Fly     3 LESFLLGAVYYYGLFIGLSNF----EFDWNTGRVFTKKW----STLYAIALDSCIFALYIYHWTG 59

  Fly    76 KTN--------------RVLQVLHGMRLVLSIPNVAVILCYHIFRGPEIIDLINQFLRLF----- 121
            .||              .|:.:|.|:|:|..:  ..:||.:  ::..:::||.::.:|::     
  Fly    60 NTNIVNAIFGRANMLHEYVVAILTGLRIVTGL--FTLILRW--YQRCKMMDLASKVVRMYVARPQ 120

  Fly   122 -RQVSD-------LFKTKTPGFGGRRELILILLNLISFAHEQTYLWFTIRKGFSWRFLIDWWCDF 178
             |::|.       :|.:.|.|.     .:.::|:.:.....|.||...::   .|.|:|      
  Fly   121 VRRMSRWGILTKFIFGSITDGL-----QMAMVLSAMGSVDSQFYLGLGLQ---YWMFVI------ 171

  Fly   179 YLVSATNIFIHINSIGYLSLGVLYSELNKYVYTNLRIQLQKLNT--------------------- 222
                             |::.::...:   :...:|.|.|.:||                     
  Fly   172 -----------------LNMAMMQQHM---IMLFVRTQFQLINTELRQVIDEAKDLLLSPRHQGV 216

  Fly   223 --------SGSKQKIRRVQNRLEKCISLYREIY-----HTSIMFHKLFVPLLFLALIYKV----- 269
                    :...:.|.|:|::|:..::...|::     .|...::...|...:||  |.:     
  Fly   217 FMTKCCSLADQIENIARIQSQLQTIMNQMEEVFGIQGAMTYGGYYLSSVGTCYLA--YSILKHGY 279

  Fly   270 ------LLIALIGFNVAVEFYLNSFI-FWILLGKHVLDLFLVTVSVEGAVNQFLNIGMQFGNVGD 327
                  |...::.::....:||:..: ..::|  ||.|.:...:.:.|....|:.:.:       
  Fly   280 ENLSMTLSTVILAYSWCFFYYLDGMLNLSVML--HVQDDYWEMLQILGKRTIFVGLDV------- 335

  Fly   328 LSKFQTTLDTLFLHLRLGHFRVSILGLFDVTQMQYLQFLSALLSGLAFIAQYRMQ 382
              :.:...:.|.|.|.....:::::.|:|||:...:.....|::...|:.||.::
  Fly   336 --RLEEAFENLNLQLIRNPLKITVVKLYDVTRSNTMAMFGNLITHSIFLIQYDIE 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 75/438 (17%)
Gr36cNP_724040.1 7tm_7 8..389 CDD:285581 75/440 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.