DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr92a and Gr59a

DIOPT Version :9

Sequence 1:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster


Alignment Length:407 Identity:71/407 - (17%)
Similarity:147/407 - (36%) Gaps:120/407 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YAQFIGVIFFCLHTR---KDDKTVFIRNWL-KWLNVTHRIITFTRFFWVYIASISIKTNRVLQVL 84
            |...|..||..|...   |..|.:...:|: .::.||..|:....:..:....|| :..|...::
  Fly    36 YCLLINAIFLTLLPSAFWKSAKLLSTADWMPSYMRVTPYIMCTINYAAIAYTLIS-RCYRDAMLM 99

  Fly    85 HGMRLVLSIPNVAVILCYHIFRGPEIIDLINQFLRLFRQVSDL------FKTKTPGFGGRRELIL 143
            ...|:||.:.                    .:.||..::::.|      .||.|..:.....::.
  Fly   100 DLQRIVLEVN--------------------REMLRTGKKMNSLLRRMFFLKTFTLTYSCLSYILA 144

  Fly   144 ILLNLISFAHEQTYLWFTIRKGFSWRFLIDWWCDFYLVSAT------NIFIHINSIGYLSLGVLY 202
            :.:          |.|    |..:|..|    |:..||:.:      |.|.:..|:.:::.|   
  Fly   145 VFI----------YQW----KAQNWSNL----CNGLLVNISLTILFVNTFFYFTSLWHIARG--- 188

  Fly   203 SELNKYVYTNLRIQLQKLN--TSGSKQKIRRVQNRLEKCISLYREIYHTSIMFHKLFVPLLFLAL 265
                 |.:.|     |:||  .:.....:.|....|....:|:|.:.:|:...:|.:.|.: ||:
  Fly   189 -----YDFVN-----QQLNEIVACQSMDLERKSKELRGLWALHRNLSYTARRINKHYGPQM-LAM 242

  Fly   266 IYKVLLIALIGFNV-----------AVEFYLNSFIFWI-----LLGKHVLDL----------FLV 304
            .:...:.::|...:           ::|....|.|:|:     .|..::.||          |..
  Fly   243 RFDYFIFSIINACIGTIYSTTDQEPSLEKIFGSLIYWVRSFDFFLNDYICDLVSEYQMQPKFFAP 307

  Fly   305 TVSVEGAVNQFLNIGMQFGNVGDLSKFQTTLDTLFLHLRLGHFRVSILGLFDVTQMQYLQFLSAL 369
            ..|:...::.:|           :.:..|.||.|            :.||:.|.:.::||.:.::
  Fly   308 ESSMSNELSSYL-----------IYESSTRLDLL------------VCGLYRVNKRKWLQMVGSI 349

  Fly   370 LSGLAFIAQYRMQVGNG 386
            :...:.:.|:.:.:..|
  Fly   350 VVHSSMLFQFHLVMRGG 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 70/401 (17%)
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 70/402 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.