DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr92a and Gr59b

DIOPT Version :9

Sequence 1:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_523818.2 Gene:Gr59b / 117484 FlyBaseID:FBgn0045482 Length:366 Species:Drosophila melanogaster


Alignment Length:399 Identity:80/399 - (20%)
Similarity:160/399 - (40%) Gaps:75/399 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ILRYIFRYAQFIGVIFFCLHTRKDDKTVFIRNWLKWLNVTHRIITFTRFFWVYIASISIKT-NRV 80
            :::..|||:..||:.......||...|:|.|.:....|:...|:.....:.|.:.....|| .::
  Fly     5 MIKLYFRYSLAIGITSQQFSNRKFFSTLFSRTYALIANIVTLIMLPIVMWQVQLVFQQKKTFPKL 69

  Fly    81 LQVLHGMRLVLSIPNVAVILCYHI----FRGPEIIDLINQFLRLFRQVSDL-FKTKTPGFGGRRE 140
            :.:.:.:|..:|.    :::.|.:    ||.....::....|.|||:.... ||    |.||.|.
  Fly    70 ILITNNVREAVSF----LVILYTVLSRGFRDTAFKEMQPLLLTLFREEKRCGFK----GIGGVRR 126

  Fly   141 LILILLNLISFAHEQTYLWFTIRKGFSWRFLID-----------WWCD---FYLVSATNIFIHIN 191
            .:.||| .:.|        ||:    ||..:.|           .|.:   |:....||..:.:.
  Fly   127 SLRILL-FVKF--------FTL----SWLCVTDVLFLLYSTDALIWVNVLRFFFKCNTNNILEMV 178

  Fly   192 SIGYLSLGVLYSELNKYVYTNLRIQLQKLNTSGSKQKIRRVQN--RLEKCISLYREIYHTSIMFH 254
            .:||..  .|:.....:...|.|  |.::..|.|.:|.|.:|:  .|..|::      .|::..:
  Fly   179 PMGYFL--ALWHIARGFDCVNRR--LDQIVKSKSTRKHRELQHLWLLHACLT------KTALNIN 233

  Fly   255 KLFVPLL-------FLALIYKVLLIALIGFNVAVEFYLNSFIFWILLGK---HV--LDLFLVTVS 307
            |::.|.:       |:..:.:....|:..|:::..|      ||::.|.   ||  ||.:|:...
  Fly   234 KIYAPQMLASRFDNFVNGVIQAYWGAVFTFDLSTPF------FWVVYGSVQYHVRCLDYYLIDNM 292

  Fly   308 VEGAVNQFLNIGMQFGNVGDLSKFQTTLDTLFLHLRLGHFRVSILGLFDVTQMQYLQFLSALLSG 372
            .:.||....:....:..|    ::...:.:..::......::...|||...:..:...:|::|..
  Fly   293 CDVAVEYHDSAKHSWSEV----RWTKEISSYVIYANSTKLQLWSCGLFQANRSMWFAMISSVLYY 353

  Fly   373 LAFIAQYRM 381
            :..:.|:.:
  Fly   354 ILVLLQFHL 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 80/398 (20%)
Gr59bNP_523818.2 7tm_7 6..364 CDD:285581 80/398 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.