DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr92a and Gr98c

DIOPT Version :9

Sequence 1:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_524531.2 Gene:Gr98c / 117336 FlyBaseID:FBgn0046886 Length:408 Species:Drosophila melanogaster


Alignment Length:265 Identity:51/265 - (19%)
Similarity:95/265 - (35%) Gaps:90/265 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 FFWVYIASISIKTNRVLQVLHGMRLVLSIPNVAVILCYHIFRGPE---IIDLINQFLRLFRQVSD 126
            |.||         |:||              ..:||.....:|||   .:.|:.:.:...|.|.:
  Fly   174 FHWV---------NQVL--------------TQIILIMLQLKGPEYCLFVLLVYELILRTRHVLE 215

  Fly   127 LFKTKTPGF--GGRRELILILLNLISFAHEQTYLWFTIRKGFSWRFLIDWWCDFYLVSATNIFIH 189
            ..|.....|  |.|.:.:.:.|       :|..|..    |..|| |:|....::..|.|.:|::
  Fly   216 QLKDDLEDFDCGARIQELCVTL-------KQNQLLI----GRIWR-LVDEIGAYFRWSMTLLFLY 268

  Fly   190 ---------------------------INSIGYLSLGVL----YSELNKYVYTNLRIQLQKLNTS 223
                                       :.||.:||..:|    :||.....|.::...|.::...
  Fly   269 NGLTILHVVNWAIIRSIDPNDCCQLNRLGSITFLSFNLLLTCFFSECCVKTYNSISYILHQIGCL 333

  Fly   224 GSKQKIRRVQNRLEKCISLYREIYHTSIMFH---------KLFVPLLFLALIYKVLLI------- 272
            .:.::.:.::..|::.|   .::.|..::|.         |||..:|.....|.::::       
  Fly   334 PTAEEFQMLKMGLKEYI---LQMQHLKLLFTCGGLFDINIKLFGGMLVTLCGYVIIIVQFKIQDF 395

  Fly   273 ALIGF 277
            ||||:
  Fly   396 ALIGY 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 51/265 (19%)
Gr98cNP_524531.2 7tm_7 15..393 CDD:285581 47/256 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.