DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr92a and Gr98b

DIOPT Version :9

Sequence 1:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_733213.1 Gene:Gr98b / 117327 FlyBaseID:FBgn0046887 Length:403 Species:Drosophila melanogaster


Alignment Length:423 Identity:72/423 - (17%)
Similarity:154/423 - (36%) Gaps:134/423 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RYAQFIGVIFFCLHTRKDDKTVFIRNWLKWLNVTHRIITFTRFFWVYIASISIKTNRVLQVLHGM 87
            |:....|.:|:.....   .||||.::...:.:...::.:         ::|..|..:..:...:
  Fly    40 RWYLMTGYVFYATAIL---ATVFIVSYFNIIAIDEEVLEY---------NVSDFTRVMGNIQKSL 92

  Fly    88 RLVLSIPN-VAVILCYHIFRGPEIIDLINQFLRLFRQVSDL---FKTKTPGFGGRRELILILLNL 148
            ..:::|.| :.:::.|....|            :::.::||   ....:..|||:|:        
  Fly    93 YSIMAIANHLNMLINYRRLGG------------IYKDIADLEMDMDEASQCFGGQRQ-------- 137

  Fly   149 ISFAHEQTYLWFTIRKGFSWRFLIDWWCDFYLVSATNIFIHINSIGYLSLGVLYSELNKYVYTNL 213
                            .||:||.:......:::      :.:.|:..|::    :.:..:|.|.|
  Fly   138 ----------------RFSFRFRMALCVGVWMI------LMVGSMPRLTM----TAMGPFVSTLL 176

  Fly   214 RI---------QLQKLN-------TSGSKQKIRRVQNRLEK--------------CISLYR---- 244
            :|         ||:.|.       ......::||..::|::              |::|.|    
  Fly   177 KILTEFVMIMQQLKSLEYCVFVLIIYELVLRLRRTLSQLQEEFQDCEQQDMLQALCVALKRNQLL 241

  Fly   245 --EIYHTSIMFHKLFVPLLFLALIYKVLLIALIGFNVAVEFYLNSFIF--------WILLGKHVL 299
              .|:.........|.|.:.|..:|..|.| |...|.|   |:|.|::        :::....::
  Fly   242 LGRIWRLEGDVGSYFTPTMLLLFLYNGLTI-LHMVNWA---YINKFLYDSCCQYERFLVCSTLLV 302

  Fly   300 DLFLVTVSVEGAVNQFLNIGMQFGNVGDLSKFQ-TTLDTLFL--------------HLRLGHFRV 349
            :|.|..:..:..:|.: |.   |..:  |.|.: |:.|..|.              ||:|   |.
  Fly   303 NLLLPCLLSQRCINAY-NC---FPRI--LHKIRCTSADPNFAMLTRGLREYSLQMEHLKL---RF 358

  Fly   350 SILGLFDVTQMQYLQFLSALLSGLAFIAQYRMQ 382
            :..||||:....:...|..:...:..:.|:::|
  Fly   359 TCGGLFDINLKYFGGLLVTIFGYIIILIQFKVQ 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 71/421 (17%)
Gr98bNP_733213.1 7tm_7 13..391 CDD:285581 71/421 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.