DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93b and Gr68a

DIOPT Version :9

Sequence 1:NP_732664.2 Gene:Gr93b / 117472 FlyBaseID:FBgn0045470 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster


Alignment Length:387 Identity:77/387 - (19%)
Similarity:146/387 - (37%) Gaps:110/387 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 WSGQYEDMYLRAFFGFRLIGC-----LICSVIILVMQFWFGEELI----------------NLVN 121
            :||..:|       |||..|.     .:.::|||:.....||:::                ..:|
  Fly    23 YSGDVDD-------GFRFGGLGRWYGRLVALIILIGSLTLGEDVLFASKEYRLVASAQGDTEEIN 80

  Fly   122 RFLQL---------------------FRRMQS--------LTNSPKNRFGDRAEFLLMFSK---V 154
            |.::.                     ||.:..        |.|..:..:..|...:|:.|.   |
  Fly    81 RTIETLLCIISYTMVVLSSVQNASRHFRTLHDIAKIDEYLLANGFRETYSCRNLTILVTSAAGGV 145

  Fly   155 FSLLFVFMAFR---------LMLSPWFLLTLVCDLYT-SVGTGMITHLCFVGYLSIGVLYRDLNN 209
            .::.|.::.:|         ::|..:||..|...|.. .:.|.|:.....:|:|:..:   |..|
  Fly   146 LAVAFYYIHYRSGIGAKRQIILLLIYFLQLLYSTLLALYLRTLMMNLAQRIGFLNQKL---DTFN 207

  Fly   210 YVDCQLRAQLRSLNGENNSFRNNPQPTRQAISNLDKCL----YLYDEIHQVSR-SFQQLFDLPLF 269
            ..||          |...::|.        :|||.:.|    |:.:.|:.|:. |....|....:
  Fly   208 LQDC----------GHMENWRE--------LSNLIEVLCKFRYITENINCVAGVSLLFYFGFSFY 254

  Fly   270 LSLAQSLLAMSMVSYHAILRRQYSFNLWGL-VIKLLIDVVLLTM------SVHSAVNG-SRLIRR 326
            ....||.||.:.::..::..:....:..|| .|.:|.:.:.:.:      .:.|.||| ::::.|
  Fly   255 TVTNQSYLAFATLTAGSLSSKTEVADTIGLSCIWVLAETITMIVICSACDGLASEVNGTAQILAR 319

  Fly   327 LSFENFYVTDSQSYHQKLELFLGRLQHQELRVFPLGLFEVSNELTLFFLSAMVTYLVFLVQY 388
            :      ...|:.:...::.||.:...|:|:....|.|.:.|.......||:.||||.|:|:
  Fly   320 I------YGKSKQFQNLIDKFLTKSIKQDLQFTAYGFFSIDNSTLFKIFSAVTTYLVILIQF 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93bNP_732664.2 7tm_7 24..391 CDD:285581 77/387 (20%)
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 77/387 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.