DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93b and Gr63a

DIOPT Version :9

Sequence 1:NP_732664.2 Gene:Gr93b / 117472 FlyBaseID:FBgn0045470 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001137883.1 Gene:Gr63a / 38453 FlyBaseID:FBgn0035468 Length:489 Species:Drosophila melanogaster


Alignment Length:394 Identity:68/394 - (17%)
Similarity:140/394 - (35%) Gaps:124/394 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 INRRGYLWICLVIRLLASCFYGYSYD-------AWSGQYEDMYLRAFFGFRLIGCLICSVIILVM 108
            :|...::: .:|..:|.:|:.||..:       :.||.:|:..:...|...::..:|..::    
  Fly   104 MNSASFIY-SVVFFVLLACYVGYVANNRIHIVRSLSGPFEEAVIAYLFLVNILPIMIIPIL---- 163

  Fly   109 QFWFG----EELINLVNRFLQLFRRMQSLTNSPKNRFGDRAEFLLMFSKVFSLLFVFMA------ 163
              |:.    .:|.|..:.|..|:.::..  :|...:...:|.::.:...:.|:|.|.:.      
  Fly   164 --WYEARKIAKLFNDWDDFEVLYYQISG--HSLPLKLRQKAVYIAIVLPILSVLSVVITHVTMSD 224

  Fly   164 --------------FRLMLSPWFLLTLVCDLYT---------------SVGTGMITHLCFVGYLS 199
                          ...||..|:.  |:|:..:               .:|...:.....|.:|.
  Fly   225 LNINQVVPYCILDNLTAMLGAWWF--LICEAMSITAHLLAERFQKALKHIGPAAMVADYRVLWLR 287

  Fly   200 IGVLYRDLNNYVDCQLRAQLRSLNGENNSFRNNPQPTRQAISNLDKCLYLYDEIHQVSRSFQQLF 264
            :..|.||..|.:                                  | |.:        .|..|:
  Fly   288 LSKLTRDTGNAL----------------------------------C-YTF--------VFMSLY 309

  Fly   265 DLPLFLSLAQSLLAMSMVSYHAILRRQYSFNLWGLVIKLLIDVVLL----------TMSVHSAVN 319
               ||.     ::.:|:....:.|...:.....||.|..|.::.||          :::|.:...
  Fly   310 ---LFF-----IITLSIYGLMSQLSEGFGIKDIGLTITALWNIGLLFYICDEAHYASVNVRTNFQ 366

  Fly   320 GSRLIRRLSFENFYVTDSQSYHQKLELFLGRLQHQELRVFPLGLFEVSNELTLFFLSAMVTYLVF 384
            ...|:..|::.|   :|:|:   ::.:||...:.....:...|.|:|:..|....|:.||||||.
  Fly   367 KKLLMVELNWMN---SDAQT---EINMFLRATEMNPSTINCGGFFDVNRTLFKGLLTTMVTYLVV 425

  Fly   385 LVQY 388
            |:|:
  Fly   426 LLQF 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93bNP_732664.2 7tm_7 24..391 CDD:285581 68/394 (17%)
Gr63aNP_001137883.1 7tm_7 79..433 CDD:285581 68/394 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.