DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93b and Gr21a

DIOPT Version :9

Sequence 1:NP_732664.2 Gene:Gr93b / 117472 FlyBaseID:FBgn0045470 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001259841.1 Gene:Gr21a / 33251 FlyBaseID:FBgn0041250 Length:447 Species:Drosophila melanogaster


Alignment Length:383 Identity:68/383 - (17%)
Similarity:136/383 - (35%) Gaps:83/383 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RRGYLW------------------ICLVIRLLASCFYGYSYDAWSGQYEDMYLRAFFGFRLIGCL 99
            |.||.|                  :.||:|.....|.        ...:..:..|.:....|..|
  Fly   100 RTGYSWGSKQVMWAIFIYSCQTTIVVLVLRERVKKFV--------TSPDKRFDEAIYNVIFISLL 156

  Fly   100 ICSVIILVMQFWFGEELINLVNRFLQLFRRMQSLTNSPKNRFGDRAEFLLMFSKVFSLLFVFMAF 164
            ..:.::.|..:..|.::....|.:.....:....|.||           ::|..::.|.:....|
  Fly   157 FTNFLLPVASWRHGPQVAIFKNMWTNYQYKFFKTTGSP-----------IVFPNLYPLTWSLCVF 210

  Fly   165 RLMLS-----------PWFLLTLVCDLYTSVGTGMITHLCFVGYL---SIGVLYRDLNNYVDCQL 215
            ..:||           |.|.|......|..:  .|:...|.:.|:   :.|...|.|::.:...:
  Fly   211 SWLLSIAINLSQYFLQPDFRLWYTFAYYPII--AMLNCFCSLWYINCNAFGTASRALSDALQTTI 273

  Fly   216 RAQLRSLNGENNSFRNNPQPTRQAISNLDKCLYLYDEIHQVSRSFQQLFDLPLFLSLAQSLLAMS 280
            |.:               :|.::........:.|...:.|:.|::..::.:...:....:::| :
  Fly   274 RGE---------------KPAQKLTEYRHLWVDLSHMMQQLGRAYSNMYGMYCLVIFFTTIIA-T 322

  Fly   281 MVSYHAILRRQYSFNLWGLVIKLLIDVVLLTMSVHSAVNGSRLIRRLSFE----NFYVTDSQSYH 341
            ..|...|:....::...||.:.:...:.||.:..:.|...||.: .|.|:    |..:|...:..
  Fly   323 YGSISEIIDHGATYKEVGLFVIVFYCMGLLYIICNEAHYASRKV-GLDFQTKLLNINLTAVDAAT 386

  Fly   342 QK-LELFLGRLQHQELRVFPL----GLFEVSNELTLFFLSAMVTYLVFLVQYGMQSQQ 394
            || :|:.|..:....    |:    |...::.||....:|.|.||||.|:|:.:..|:
  Fly   387 QKEVEMLLVAINKNP----PIMNLDGYANINRELITTNISFMATYLVVLLQFKITEQR 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93bNP_732664.2 7tm_7 24..391 CDD:285581 67/378 (18%)
Gr21aNP_001259841.1 7tm_7 75..438 CDD:285581 67/379 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.