DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93b and Gr9a

DIOPT Version :9

Sequence 1:NP_732664.2 Gene:Gr93b / 117472 FlyBaseID:FBgn0045470 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster


Alignment Length:391 Identity:81/391 - (20%)
Similarity:134/391 - (34%) Gaps:125/391 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GYLWICLVIRLLASCFYGYSYDAWSGQYEDMYLRAFFGFRLIGCLICSVIILVMQFWFGEELINL 119
            ||..:|.::     |       .|||.             .:|.|:.|..::::       ||.|
  Fly    11 GYFQLCGLV-----C-------GWSGS-------------RLGRLLSSTFLVLI-------LIEL 43

  Fly   120 VNRFLQLFRRMQSLTNSPKNRFGDRAEFLLMFSKVFSLLFVFMAFRLMLSPWFLLT--------- 175
            |......|..     .:|     |.......|:||  ::.|.||:: |:..|..|:         
  Fly    44 VGEIETYFTE-----ENP-----DNESVPAYFAKV--IMGVNMAYK-MIHAWIALSALFECRRFR 95

  Fly   176 -LVCDLYTSVGTGMI-THLCFVGYLSIGVLYRDLNNYVDCQLRAQLRSLNGENNSFRNNPQPTRQ 238
             |:.:|.....|..| .||.....|.....:..|:.|.       :|.:..||..:..:.|..|.
  Fly    96 YLLEELPPVKATSFIYRHLILEIILFACNAFLVLSEYT-------IRGIYLENLRYAYSLQAVRA 153

  Fly   239 -------AISNLD-----------------KCLYL-YDEIHQVSRSFQQLFDLPLF----LSLAQ 274
                   .:..||                 |.|.| |..:.:|:||...||.|.|.    |.|..
  Fly   154 RYLQMMVLVDRLDGKLEQLHHRVISGSSDYKTLRLDYAHLAKVTRSLSHLFGLSLLLLNVLCLGD 218

  Fly   275 SLLAMS---MVSYHAILRRQYSFNLWG----LVIKLLIDVVLLTMSVHSAVN------------- 319
            .::..:   ||:|..:|  ..:..|:|    :|...||.:..:..:.|..|:             
  Fly   219 WIIVCNVYFMVAYLQVL--PATLFLFGQVMFVVCPTLIKIWSICAASHRCVSKSKHLQQQLKDLP 281

  Fly   320 GSRLIRRLSFENFYVTDSQSYHQKLELFLGRLQHQELRVFPLGLFEVSNELTLFFLSAMVTYLVF 384
            |...:.|...|.|.:   |.....:::.:..:.|..|:.. .|:|       .|.|.|:|.:|.|
  Fly   282 GQTPVERSQIEGFAL---QIMQDPIQIDVCGIYHLNLQTL-AGMF-------FFILEALVIFLQF 335

  Fly   385 L 385
            :
  Fly   336 V 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93bNP_732664.2 7tm_7 24..391 CDD:285581 81/391 (21%)
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 80/388 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.