DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93b and Gr10a

DIOPT Version :9

Sequence 1:NP_732664.2 Gene:Gr93b / 117472 FlyBaseID:FBgn0045470 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster


Alignment Length:433 Identity:97/433 - (22%)
Similarity:138/433 - (31%) Gaps:164/433 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 YGYSYDAWSGQYEDMYL--RAF-FGFRLI----GCLICSVIILVMQFWFGEELINLVNRFLQLFR 128
            ||:.|....||....|:  ||. .|.:::    |.|...::|:|:..:|......|.:   .|.|
  Fly    21 YGHVYALIYGQVVIDYVPQRALKRGVKVLLIAYGHLFSMLLIVVLPGYFCYHFRTLTD---TLDR 82

  Fly   129 RMQ-----SLTNS------------------------------------------PKNRFGDRAE 146
            |:|     |.||:                                          ||..|    |
  Fly    83 RLQLLFYVSFTNTAIKYATVIVTYVANTVHFEAINQRCTMQRTHLEFEFKNAPQEPKRPF----E 143

  Fly   147 FLLMFSKVFSLLFVFMAFRLMLSPWFLLTLVCDL---YTSVGTGMIT----HLCFVGYLSIGVLY 204
            |             ||.|:..|....::..||.:   |..||.|.::    |.....:    ||:
  Fly   144 F-------------FMYFKFCLINLMMMIQVCGIFAQYGEVGKGSVSQVRVHFAIYAF----VLW 191

  Fly   205 RDLNNYVD-C------------QLRAQLRSLNGENNSFRNNPQPTRQAISNLDKCLYLYD----- 251
            ....|..| |            |...||.||..|.:..|....       .|..|..|.|     
  Fly   192 NYTENMADYCYFINGSVLKYYRQFNLQLGSLRDEMDGLRPGGM-------LLHHCCELSDRLEEL 249

  Fly   252 -----EIHQVSR-SFQ----QLFDLPL---------FLSLAQSLLAMSM--VSYHAILRRQYSFN 295
                 |||.:.| ||:    ||..|.|         |.:|...|...|:  |||..::...|:..
  Fly   250 RRRCREIHDLQRESFRMHQFQLIGLMLSTLINNLTNFYTLFHMLAKQSLEEVSYPVVVGSVYATG 314

  Fly   296 LW------GLV---IKLLIDVVLLTMS--VHSAVNGSRLIRRLSFENFYVTDSQSYHQKLELFLG 349
            .:      .|:   |||.::.|.|||.  ........||.|.:.            |..|||   
  Fly   315 FYIDTYIVALINEHIKLELEAVALTMRRFAEPREMDERLTREIE------------HLSLEL--- 364

  Fly   350 RLQHQELRVFPL--GLFEVSNELTLFFLSAMVTYLVFLVQYGM 390
             |.:|.    |:  ||..:...|.........:|.:.|||:.:
  Fly   365 -LNYQP----PMLCGLLHLDRRLVYLIAVTAFSYFITLVQFDL 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93bNP_732664.2 7tm_7 24..391 CDD:285581 97/433 (22%)
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 97/431 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.