DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93b and Gr22c

DIOPT Version :9

Sequence 1:NP_732664.2 Gene:Gr93b / 117472 FlyBaseID:FBgn0045470 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_722732.2 Gene:Gr22c / 117499 FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster


Alignment Length:439 Identity:87/439 - (19%)
Similarity:142/439 - (32%) Gaps:182/439 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 WICLVIRLLASCFYG---YSYDAWSGQYEDMYLRAFFG----FRLIGCLICS------------- 102
            ||.|...|.:|.|.|   |.:|:.:||.:......|:|    |.|:..::||             
  Fly    14 WIILKATLYSSWFLGVFPYRFDSRNGQLKRSRFLLFYGLILNFFLLLKMVCSGGQKLGIPEAFAR 78

  Fly   103 -------------------VIILVMQFWFGEELINLVNRFLQL-FRRMQSL--TNSPK-NRFGDR 144
                               |:|..:.||....:.:|.|..|.| :::..||  |..|| |.|   
  Fly    79 NSVLENTHYTTGMLAVFSCVVIHFLNFWGSTRVQDLANELLVLEYQQFASLNETKCPKFNSF--- 140

  Fly   145 AEFLLMFSKVFSLLFVFMAFRLMLSPWFLLTLVCDLYTSVGTG-----------MITHL------ 192
                 :..|..|::      .|:||           |.|:..|           :|..|      
  Fly   141 -----VIQKWLSVI------GLLLS-----------YLSIAYGLPGNNFSVEMVLINSLVQFSFN 183

  Fly   193 CFVGYLSIGVL--YRDL------------NNYVDCQLRAQLRSLNGENNSFRNNPQPTRQAISNL 243
            |.:.:..||||  ||.|            |..:||.:.:                       |.:
  Fly   184 CNIMHYYIGVLLIYRYLWLINGQLLEMVTNLKLDCSVDS-----------------------SRI 225

  Fly   244 DKCLYLYDEIHQVS----RSFQQLFDLPLFLSLAQSLLA--------MSM---VSYHAILRRQYS 293
            .|.|.||..:.::.    .:::....|.|...||.:.||        :||   ..|..|......
  Fly   226 RKYLSLYRRLLELKGYMVATYEYHMTLVLTTGLASNFLAIYSWIVLDISMNINFIYLLIFPLFLL 290

  Fly   294 FNLWGL-------------------VIKLLIDVVLLTMSVHSAVNGSRLIRRLSFENFYVTDSQS 339
            .|:|.|                   |:||..|:.:..:.:..:||...|:......||:|     
  Fly   291 VNVWNLWLSIAASDLAENAGKSTQTVLKLFADLEVKDIELERSVNEFALLCGHCQFNFHV----- 350

  Fly   340 YHQKLELFLGRLQHQELRVFPLGLFEVSNELTLFFLSAMVTYLVFLVQY 388
                                 .|||.::.::....:.....||::::|:
  Fly   351 ---------------------CGLFTINYKMGFQMIITSFLYLIYMIQF 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93bNP_732664.2 7tm_7 24..391 CDD:285581 87/439 (20%)
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 85/436 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.