DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93b and Gr59b

DIOPT Version :9

Sequence 1:NP_732664.2 Gene:Gr93b / 117472 FlyBaseID:FBgn0045470 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_523818.2 Gene:Gr59b / 117484 FlyBaseID:FBgn0045482 Length:366 Species:Drosophila melanogaster


Alignment Length:407 Identity:72/407 - (17%)
Similarity:150/407 - (36%) Gaps:123/407 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 YLWICLVIRLLASCFYGYSYDAWSGQYEDMYLRAFFG--FRLIGCLICSVIILVM---QFWFGEE 115
            |..|.|..|      |..:....|.|:.:   |.||.  |.....||.:::.|:|   ..|    
  Fly     3 YWMIKLYFR------YSLAIGITSQQFSN---RKFFSTLFSRTYALIANIVTLIMLPIVMW---- 54

  Fly   116 LINLVNRFLQLFRRMQSLTNSPKNRFGDRAEFLLMFSKVFSLLFVFMAFR--------------- 165
            .:.||.:..:.|.::..:||:.:    :...||::...|.|..|...||:               
  Fly    55 QVQLVFQQKKTFPKLILITNNVR----EAVSFLVILYTVLSRGFRDTAFKEMQPLLLTLFREEKR 115

  Fly   166 ---------------LMLSPWFLLTLVCDLYTSVGTGMITHLCFVGYLSIGVLYRD-LNNYVDCQ 214
                           |:...:|.|:.:|          :|.:.|:.|.:..:::.: |..:..| 
  Fly   116 CGFKGIGGVRRSLRILLFVKFFTLSWLC----------VTDVLFLLYSTDALIWVNVLRFFFKC- 169

  Fly   215 LRAQLRSLNGENNSFRNNPQPTRQAISNLDK---CL-YLYDEI--HQVSRSFQQLFDL-PLFLSL 272
                     ..||.....|.....|:.::.:   |: ...|:|  .:.:|..::|..| .|...|
  Fly   170 ---------NTNNILEMVPMGYFLALWHIARGFDCVNRRLDQIVKSKSTRKHRELQHLWLLHACL 225

  Fly   273 AQSLLAMSMVSYHAILRRQYSFNL--------WGLVIKLLID-----VVLLTMSVHSAVNGSRLI 324
            .::.|.::.:....:|..::. |.        ||.|....:.     ||..::..|        :
  Fly   226 TKTALNINKIYAPQMLASRFD-NFVNGVIQAYWGAVFTFDLSTPFFWVVYGSVQYH--------V 281

  Fly   325 RRLSFENFYVTDSQ-----SYH-------------QKLELFLGRLQHQELRVFPLGLFEVSNELT 371
            |.|   ::|:.|:.     .||             :::..::......:|:::..|||:.:..:.
  Fly   282 RCL---DYYLIDNMCDVAVEYHDSAKHSWSEVRWTKEISSYVIYANSTKLQLWSCGLFQANRSMW 343

  Fly   372 LFFLSAMVTYLVFLVQY 388
            ...:|:::.|::.|:|:
  Fly   344 FAMISSVLYYILVLLQF 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93bNP_732664.2 7tm_7 24..391 CDD:285581 72/407 (18%)
Gr59bNP_523818.2 7tm_7 6..364 CDD:285581 71/404 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.