DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93b and Gr22f

DIOPT Version :9

Sequence 1:NP_732664.2 Gene:Gr93b / 117472 FlyBaseID:FBgn0045470 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster


Alignment Length:395 Identity:81/395 - (20%)
Similarity:149/395 - (37%) Gaps:79/395 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LYGTF-FGVITFRIERKDSQLVAINRRGYLWICL---VIRLLASCFYGYS---------YDAWSG 80
            ||.:: .|:..|..:.:..||     :...|:.|   |:..||.|....|         |:|:..
  Fly    23 LYASWLLGLFPFTFDSRRKQL-----KRSRWLLLYGFVLHSLAMCLAMSSHLASKQRRKYNAFER 82

  Fly    81 Q--YEDMYLRAFFGFRLIGCLICSVIILVMQFWFGEELINLVNRFLQL---FRRMQSLTNSPK-N 139
            .  .|.:|::    |::......||::| |..|....:..:.|..|.|   .:.:.:|.|.|. |
  Fly    83 NPLLEKIYMQ----FQVTTFFTISVLLL-MNVWKSNTVRKIANELLTLEGQVKDLLTLKNCPNFN 142

  Fly   140 RFGDRAEFLLMFSKVFSLLFVFMAFRLMLSPWFLLTLVCDLYTSVGTGM-ITHLCFVGYLSIGVL 203
            .|..:.....:...|.|:.|........  |..|..|.|  ..|||..: |.|.    :..|.::
  Fly   143 CFVIKKHVAAIGQFVISIYFCLCQENSY--PKILKILCC--LPSVGLQLIIMHF----HTEIILV 199

  Fly   204 YRDLNNYVDCQLRAQLRSLNGENNSFRNNPQPTRQAISNLDKCLYLYDEIHQVSRSFQQLFDLPL 268
            ||    ||..           .|.:..::...:...|..|..   |||.:.::|.......||.|
  Fly   200 YR----YVWL-----------VNETLEDSHHLSSSRIHALAS---LYDRLLKLSELVVACNDLQL 246

  Fly   269 FLSLAQSLLAMSMVSYHAI-----LRRQYSF---------NLWGLVIKLLIDVVLLTMSVHSAVN 319
            .|.|...|:..::..:..|     :.::|.:         |.|    ...:::|:..::......
  Fly   247 ILMLIIYLIGNTVQIFFLIVLGVSMNKRYIYLVASPQLIINFW----DFWLNIVVCDLAGKCGDQ 307

  Fly   320 GSRLIRRLS-FENFYVTDSQSYHQKLELFLGRLQHQELRVFPLGLFEVSNELTLFFLSAMVTYLV 383
            .|::::..: .|:    |.:...:.|..|.....|::.|....|||.:::.:....:.....|||
  Fly   308 TSKVLKLFTDLEH----DDEELERSLNEFAWLCTHRKFRFQLCGLFSINHNMGFQMIITSFLYLV 368

  Fly   384 FLVQY 388
            :|:|:
  Fly   369 YLLQF 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93bNP_732664.2 7tm_7 24..391 CDD:285581 81/395 (21%)
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 81/395 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.