DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93b and Gr94a

DIOPT Version :9

Sequence 1:NP_732664.2 Gene:Gr93b / 117472 FlyBaseID:FBgn0045470 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_732816.1 Gene:Gr94a / 117339 FlyBaseID:FBgn0041225 Length:404 Species:Drosophila melanogaster


Alignment Length:308 Identity:74/308 - (24%)
Similarity:130/308 - (42%) Gaps:43/308 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LINLVNRFLQLFRRMQSLTNSPKNRFGDRAEFLL----MFSKVFSLLFVFMAFRLMLSPWFLL-- 174
            :||.|::.:......:.|:..|  .|....||.|    ::..:...|...:||.|.:...|:|  
  Fly    94 VINYVSQMIISDHVAKVLSKVP--FFDTLKEFRLDSRSLYISIVLALVKTVAFPLTIEVAFILQQ 156

  Fly   175 -------TLVCDLYTSVGTGMITHL--CFVGYLSIGVLYRDLNNYVDCQLRAQLRSLN--GENNS 228
                   :|:..||......:...|  |:.|.:   |:.:::...::.:|.|||:.:|  ...:.
  Fly   157 RRQHPEMSLIWTLYRLFPLIISNFLNNCYFGAM---VVVKEILYALNRRLEAQLQEVNLLQRKDQ 218

  Fly   229 FRNNPQPTRQ----AISN-LDKCLYLYDEIHQVSRSFQQLFDLPLFLSLAQSLLAMSMVSYH--- 285
            .:...:..|.    |::: ||:..|.|..|:..|..:.....|.:.|||...||.:::..|.   
  Fly   219 LKLYTKYYRMQRFCALADELDQLAYRYRLIYVHSGKYLTPMSLSMILSLICHLLGITVGFYSLYY 283

  Fly   286 -----AILRRQYS-----FNLWGLVIKLLIDVVLLT-MSVHSAVNGSRLIRRLSFENFYVTDSQS 339
                 .|:.:.|.     .||..|.|. |.::.||| :..|..|...|....|...|....||: 
  Fly   284 AIADTLIMGKPYDGLGSLINLVFLSIS-LAEITLLTHLCNHLLVATRRSAVILQEMNLQHADSR- 346

  Fly   340 YHQKLELFLGRLQHQELRVFPLGLFEVSNELTLFFLSAMVTYLVFLVQ 387
            |.|.:..|...:...:.::.||||:|:...|.....||:.::|:.|||
  Fly   347 YRQAVHGFTLLVTVTKYQIKPLGLYELDMRLISNVFSAVASFLLILVQ 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93bNP_732664.2 7tm_7 24..391 CDD:285581 74/308 (24%)
Gr94aNP_732816.1 7tm_7 19..399 CDD:285581 74/308 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.