DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93b and Gr97a

DIOPT Version :9

Sequence 1:NP_732664.2 Gene:Gr93b / 117472 FlyBaseID:FBgn0045470 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001287551.1 Gene:Gr97a / 117338 FlyBaseID:FBgn0041224 Length:425 Species:Drosophila melanogaster


Alignment Length:426 Identity:87/426 - (20%)
Similarity:173/426 - (40%) Gaps:90/426 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LNVSRISAILLRSCF---LYGTFFGVITFRIERKDSQLVAINRRGYLWICLVIRLLASCFYGYS- 74
            |:...::..|..:.|   |||.:.|..:||.::      .:..:|.....|.:....:.||.:: 
  Fly    28 LHTQLVTICLYATVFLNILYGVYLGRFSFRRKK------FVFSKGLTIYSLFVATFFALFYIWNI 86

  Fly    75 YDAWS-GQYEDMYLRAFFGFRLIGCL--ICSVIILVMQFWFGEELINLVNRF---LQLFRRMQSL 133
            |:..| ||   :.||...|   |.|.  :|..:...:..|  |:.:.:: ||   :.||:.:.||
  Fly    87 YNEISTGQ---INLRDTIG---IYCYMNVCVCLFNYVTQW--EKTLQII-RFQNSVPLFKVLDSL 142

  Fly   134 TNSPKNRFGDRAEFLLMFSKVFSLLFVFMA-----FRLML--------SPWFLLTLVCDLYTSVG 185
                     |.:..::..:.::.||.:...     ..|:|        |.|..:|....:...:.
  Fly   143 ---------DISAMIVWRAFIYGLLKIVFCPLITYITLILYHRRSISESQWTSVTTTKTMLPLIV 198

  Fly   186 TGMITHLCFVGYLSIGVLYRDLNNYVDCQLRAQLRSLNGENNSFRNNPQPTRQAISNLDKCLY-- 248
            :..|.: ||.|.|.       |.|.:...:..:|..:..|.|..::..|      .||.|..|  
  Fly   199 SNQINN-CFFGGLV-------LANLIFAAVNRKLHGIVKEANMLQSPVQ------MNLHKPYYRM 249

  Fly   249 --------LYDEIHQV-------SRSFQQLFDLPLFLSLAQSLLAMSMVSYHAILR------RQY 292
                    |.||:.:.       |:::.:..|..:.||:..:||.::|..|:..|.      .:.
  Fly   250 RRFCELADLLDELARKYGFTASRSKNYLRFTDWSMVLSMLMNLLGITMGCYNQYLAIADHYINEE 314

  Fly   293 SFNLW-GLVIKLLIDVVLLTMSVHSAVNGSRLI--RRLS--FENFYVTDSQS-YHQKLELFLGRL 351
            .|:|: .:|:.:.:.|..|.:.:.:.::...|:  ||..  .:.|.:..:.: :.|.:..|..::
  Fly   315 PFDLFLAIVLVVFLAVPFLELVMVARISNQTLVETRRTGELLQRFDLQHADARFKQVVNAFWLQV 379

  Fly   352 QHQELRVFPLGLFEVSNELTLFFLSAMVTYLVFLVQ 387
            .....::.||||.|::..|.....|:.:..|:.|:|
  Fly   380 VTINYKLMPLGLLELNTSLVNKVFSSAIGSLLILIQ 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93bNP_732664.2 7tm_7 24..391 CDD:285581 85/416 (20%)
Gr97aNP_001287551.1 7tm_7 54..419 CDD:285581 80/400 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.