DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93b and Gr98c

DIOPT Version :9

Sequence 1:NP_732664.2 Gene:Gr93b / 117472 FlyBaseID:FBgn0045470 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_524531.2 Gene:Gr98c / 117336 FlyBaseID:FBgn0046886 Length:408 Species:Drosophila melanogaster


Alignment Length:419 Identity:80/419 - (19%)
Similarity:152/419 - (36%) Gaps:145/419 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RRGYLWICLVIRLLASCFYGYSYDAWSGQYEDMYLRAFFGFRLIGCLICSVIILVMQFWFGEELI 117
            ||.:.|:.           |||          :||               :.||:|.|:  |...
  Fly    40 RRRFCWMA-----------GYS----------LYL---------------IAILLMVFY--EFHA 66

  Fly   118 NLVNRFLQLFR-RMQSLTNSPKNRFGDRAEFLLMFSKVFSLLFVFMAF-RLML------------ 168
            |:|:..|:::: .::..:..    .|...:||::.....:.|.:.:.: ||.|            
  Fly    67 NIVSLHLEIYKFHVEDFSKV----MGRTQKFLIVAIATCNQLNILLNYGRLGLIYDEIANLDLGI 127

  Fly   169 ----------SPWFLLTLVCDLYTSVGTGMITHLCFVGYLSIGVL--YRDLNNYVDCQLRAQLRS 221
                      |.|:...|  .|..|:|..|:..:..:..|::|..  :....|.|..|:...:..
  Fly   128 DKSSKNFCGKSHWWSFRL--RLTLSIGLWMVIIIGVIPRLTLGRAGPFFHWVNQVLTQIILIMLQ 190

  Fly   222 LNGENNSFRNNPQPTRQAISNLDKCLY---LYDEIHQVSRSFQQL------FDL-----PLFLSL 272
            |.|.                  :.||:   :|:.|.:.....:||      ||.     .|.::|
  Fly   191 LKGP------------------EYCLFVLLVYELILRTRHVLEQLKDDLEDFDCGARIQELCVTL 237

  Fly   273 AQSLLAMSMVSYHAILRRQYSFNLWGLVIKLLIDVVLLTMSVHSAVNGS----------RL--IR 325
            .|:.|.:..:  ..::....::..|.:.:..|.:.:.:...|:.|:..|          ||  |.
  Fly   238 KQNQLLIGRI--WRLVDEIGAYFRWSMTLLFLYNGLTILHVVNWAIIRSIDPNDCCQLNRLGSIT 300

  Fly   326 RLSFENFYVT-----------DSQSY--HQ---------------KLELFLGRLQHQELRVFPLG 362
            .||| |..:|           :|.||  ||               .|:.::.::||.:|.....|
  Fly   301 FLSF-NLLLTCFFSECCVKTYNSISYILHQIGCLPTAEEFQMLKMGLKEYILQMQHLKLLFTCGG 364

  Fly   363 LFEVSNELTLFFLSAMVTYLVFLVQYGMQ 391
            ||:::.:|....|..:..|::.:||:.:|
  Fly   365 LFDINIKLFGGMLVTLCGYVIIIVQFKIQ 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93bNP_732664.2 7tm_7 24..391 CDD:285581 79/417 (19%)
Gr98cNP_524531.2 7tm_7 15..393 CDD:285581 79/417 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.