DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93b and Gr98b

DIOPT Version :9

Sequence 1:NP_732664.2 Gene:Gr93b / 117472 FlyBaseID:FBgn0045470 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_733213.1 Gene:Gr98b / 117327 FlyBaseID:FBgn0046887 Length:403 Species:Drosophila melanogaster


Alignment Length:388 Identity:68/388 - (17%)
Similarity:140/388 - (36%) Gaps:128/388 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 FLQLFRRMQSLTNSPKNRFGD----RAEFLLMFSKVF------SLLFVFMAFRLM-LSPWFLLTL 176
            :|.:| .:.:||..|:: ||.    |..:.||...||      :.:|:...|.:: :....|...
  Fly    15 YLDIF-SVFALTPPPQS-FGHTPHRRLRWYLMTGYVFYATAILATVFIVSYFNIIAIDEEVLEYN 77

  Fly   177 VCDLYTSVGT---------GMITHL-CFVGYLSIGVLYRDLNNY-VDCQLRAQLRSLNGENNSFR 230
            |.|....:|.         .:..|| ..:.|..:|.:|:|:.:. :|....:|......:..|||
  Fly    78 VSDFTRVMGNIQKSLYSIMAIANHLNMLINYRRLGGIYKDIADLEMDMDEASQCFGGQRQRFSFR 142

  Fly   231 ----------------NNPQPT---------------------RQAISNLDKCLY---LYDEIHQ 255
                            :.|:.|                     .|.:.:|:.|::   :|:.:.:
  Fly   143 FRMALCVGVWMILMVGSMPRLTMTAMGPFVSTLLKILTEFVMIMQQLKSLEYCVFVLIIYELVLR 207

  Fly   256 VSRSFQQL---------------------------------------FDLP--LFLSLAQSLLAM 279
            :.|:..||                                       :..|  |.|.|...|..:
  Fly   208 LRRTLSQLQEEFQDCEQQDMLQALCVALKRNQLLLGRIWRLEGDVGSYFTPTMLLLFLYNGLTIL 272

  Fly   280 SMVSYHAILRRQY----SFNLWGLVIKLLIDVVLLTMSVHSAVNGSRLIRRLSFE--------NF 332
            .||::..|.:..|    .:..:.:...||::::|..:.....:|......|:..:        ||
  Fly   273 HMVNWAYINKFLYDSCCQYERFLVCSTLLVNLLLPCLLSQRCINAYNCFPRILHKIRCTSADPNF 337

  Fly   333 YVTDSQSYHQKLELFLGRLQHQELRVFPLGLFEVSNELTLFFLSAMVT---YLVFLVQYGMQS 392
            .:..     :.|..:..:::|.:||....|||:::.:   :|...:||   |::.|:|:.:|:
  Fly   338 AMLT-----RGLREYSLQMEHLKLRFTCGGLFDINLK---YFGGLLVTIFGYIIILIQFKVQA 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93bNP_732664.2 7tm_7 24..391 CDD:285581 67/385 (17%)
Gr98bNP_733213.1 7tm_7 13..391 CDD:285581 67/385 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.