DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93c and Gr23a

DIOPT Version :9

Sequence 1:NP_732665.1 Gene:Gr93c / 117471 FlyBaseID:FBgn0045469 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_787965.1 Gene:Gr23a / 33453 FlyBaseID:FBgn0041248 Length:374 Species:Drosophila melanogaster


Alignment Length:330 Identity:62/330 - (18%)
Similarity:121/330 - (36%) Gaps:94/330 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AFILFCSCHYGRILGVICFDIGQRTSDDSLVVRNRHQFKWFCLSCRLI---SVTAVCCFCAP-YV 75
            |||:..|...|       |.|.|...|:.:...:...:..|.:...|:   .|..:.|..|| |.
  Fly    83 AFIVVTSFLDG-------FRIKQDQLDEPIAFEDSDPWLAFTVLAMLVPTLGVEYLVCSNAPEYA 140

  Fly    76 ADIEDPYERLLQCF-RLSASLICGIC-IIVVQVCYEKELLRMIISFLRLF--------------R 124
            ..|...:.:.|..| .|...:|..|. ::.|.:...:..|:::|....|.              :
  Fly   141 FRIRIYHLKTLPSFLALQVQIISFILEVMKVNIRVRQTKLQLLILARELSCRWPQRKQKPQFSDQ 205

  Fly   125 RVRRLSSLKR------------IGFGGKREFFLLLFKFICLVYELYSEICQLWHLPDSLSLFATL 177
            :..|:..|||            .|:.|.....:::..|...|...|      |            
  Fly   206 QAHRVKDLKRRYNDLHYLFVRINGYFGGSLLTIIIVHFAIFVSNSY------W------------ 252

  Fly   178 CEIFLEIGS------LMIIHIGFVGYLSV---AALYSEVNSFARIELRRQLRSLERPVGGPVGRK 233
              :|::|.:      .:::::||:..:::   ||.:....|:   .|.||:..|...:..|.|.|
  Fly   253 --LFVDIRTRPWRIYAILLNLGFIFNVALQMAAACWHCQQSY---NLGRQIGCLISKLVKPQGSK 312

  Fly   234 QLRIVEYRVDECISVYDEI--ERVGRTFHRLLEL------PVLIILLGKIFATTILSYEVIIRPE 290
                          :|:::  |...:|.|:...:      .:.:.||..:|| .:::|.||:...
  Fly   313 --------------LYNDLVSEFSLQTLHQRFVVTAKDFFSLNLHLLSSMFA-AVVTYLVILIQF 362

  Fly   291 LYARK 295
            ::|.:
  Fly   363 MFAER 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93cNP_732665.1 7tm_7 18..393 CDD:285581 59/327 (18%)
Gr23aNP_787965.1 7tm_7 <141..362 CDD:285581 45/258 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.