DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93c and Gr9a

DIOPT Version :9

Sequence 1:NP_732665.1 Gene:Gr93c / 117471 FlyBaseID:FBgn0045469 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster


Alignment Length:172 Identity:45/172 - (26%)
Similarity:72/172 - (41%) Gaps:42/172 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 ISFLRLFRRVRRLSSLKRIGFGGKREFFLLLFKFICL-----VYELYSEICQLWHLPDSLSLFA- 175
            :.:..|.:..|.||.|    ||    ..|||...:||     |..:|..:..|..||.:|.||. 
  Fly   188 LDYAHLAKVTRSLSHL----FG----LSLLLLNVLCLGDWIIVCNVYFMVAYLQVLPATLFLFGQ 244

  Fly   176 ---TLCEIFLEIGSLMIIHIGFVGYLSVAALYSEVNSFARIELRRQLRSLERPVGGPVGRKQ--- 234
               .:|...::|.|:            .||.:..|:...  .|::||:.|  |...||.|.|   
  Fly   245 VMFVVCPTLIKIWSI------------CAASHRCVSKSK--HLQQQLKDL--PGQTPVERSQIEG 293

  Fly   235 --LRIVE--YRVDECISVYDEIERVGRTFHRLLELPVLIILL 272
              |:|::  .::|.|...:..::.:...|..:||  .|:|.|
  Fly   294 FALQIMQDPIQIDVCGIYHLNLQTLAGMFFFILE--ALVIFL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93cNP_732665.1 7tm_7 18..393 CDD:285581 45/172 (26%)
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 45/172 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.