DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93c and lite-1

DIOPT Version :9

Sequence 1:NP_732665.1 Gene:Gr93c / 117471 FlyBaseID:FBgn0045469 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_509043.3 Gene:lite-1 / 180894 WormBaseID:WBGene00001803 Length:439 Species:Caenorhabditis elegans


Alignment Length:349 Identity:65/349 - (18%)
Similarity:142/349 - (40%) Gaps:91/349 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 VVQVCYEKELLRMIISFLRLFR-RVRRLSSLK---------RIGFGGKREF----FLLLFKFICL 153
            ::.:|....:|..:::.|:|:. ..:||..||         |.....:|:|    ||.:|..:..
 Worm   115 MITLCNALIMLSGLLASLQLYTLGAKRLKPLKILCQFSLNVRTKQAERRQFMINTFLAVFSGLLA 179

  Fly   154 V------------YELYSEICQLWHLPDSLSLFATLCE---IFLEIGSLMIIHIGFVGYLSVAAL 203
            :            |.||  |....:| |:.::|..|.:   :|:...::..:.|.|..:.||   
 Worm   180 LTMAATYAMSKWGYILY--IVGTPNL-DTETIFCVLLDSYALFVSRAAISALAILFYQHCSV--- 238

  Fly   204 YSEVNSFARIELRRQLRSLERPVGGPVGRKQLRIVEYRVDECISVYDEIERVGR---TFHRLLEL 265
                       :||.::.|..           .:|....|||......::::..   ::.|:...
 Worm   239 -----------IRRSIKHLIN-----------EMVPAEQDECPLPESSLQKIHDCQISYQRIFNG 281

  Fly   266 PVLIILLGKIFATTIL--SYEVIIRPELYARKIGMWGLVVKSFADVILLTLAVHEAVSSSRMMRR 328
            ..:|    :.:.:.:|  ||.|.|....:...:||....: .:::|:.:.:.:   |::..::..
 Worm   282 KAVI----EEYYSFVLFYSYGVCIPIFCFLMFVGMSAQSI-CWSEVVSIVIWI---VNAILVLLL 338

  Fly   329 LSLENFPITD-------------HKAWHMKWEM-FLSRLNFFEFRVRPLGL-------FEVSNEV 372
            .||..|.|.:             |:.:|.:.:: .||::.||.|::....|       |.:...:
 Worm   339 FSLPAFMINEDGDRLVASSFRMYHETFHEERDLTVLSQMTFFTFQIHSTKLTLSACNYFYMDRSI 403

  Fly   373 ILLFLSSMITYFTYVVQYGIQTNR 396
            :|...|:::|||..:.::.|:.|:
 Worm   404 LLSLFSAILTYFLILWEFDIKNNQ 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93cNP_732665.1 7tm_7 18..393 CDD:285581 63/344 (18%)
lite-1NP_509043.3 7tm_7 75..425 CDD:285581 64/345 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.