DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93c and Gr39a

DIOPT Version :9

Sequence 1:NP_732665.1 Gene:Gr93c / 117471 FlyBaseID:FBgn0045469 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_724330.1 Gene:Gr39a / 117346 FlyBaseID:FBgn0264556 Length:381 Species:Drosophila melanogaster


Alignment Length:419 Identity:80/419 - (19%)
Similarity:150/419 - (35%) Gaps:152/419 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 CRLISVTAVCCFCAPYVADIEDPYERLLQCFRLSASLICGI-----------CIIVV----QVCY 108
            ||.:.:     ||..|     :|.::.   |||..|::|.|           ||.|:    :.|:
  Fly    15 CRYLGI-----FCIDY-----NPTKKK---FRLRRSVLCYIVHFALQAYLVGCISVMVTYWRRCF 66

  Fly   109 EKEL---------LRMIISF-----------------LRLFRRVR----------RLSSLKRIGF 137
            :.||         |.|:|:.                 ||:.|::.          ||...||   
  Fly    67 KSELTTTGNHFDRLVMVIALGILVVQNAWLIWLQAPHLRIVRQIEFYRRNHLANVRLLLPKR--- 128

  Fly   138 GGKREFFLLLFKFIC--LVYEL-YSEICQLWHLPDSLSLFATLCEIFLEIGSLMIIHIGF-VGYL 198
                    ||:..|.  :||.. :.:.|....|.|:..||             :|..:|| :.||
  Fly   129 --------LLWLIIATNVVYMANFIKTCIFEWLTDASRLF-------------VITSLGFPLRYL 172

  Fly   199 SVAALYSEVNSFARIELRRQL-------------RSLERPVGGPVGRKQLRIVEYRVDECISVYD 250
            ..:  ::....|..:.:.|.:             .|.:..:..| .|.:||:       |:.::|
  Fly   173 VTS--FTMGTYFCMVHIVRLVLDWNQSQINAIIDESADLKMTSP-NRLRLRV-------CLEMHD 227

  Fly   251 EIERVGRTFHRLL---ELPVL---IILLGKIFATTILSYEVIIRPELYARKIGMWGLVVKSFADV 309
            .:        .||   |:.::   |..|..:||:..::..:.:...:..:|    .:|:|...:|
  Fly   228 RL--------MLLCNDEISLVYGFIAWLSWMFASLDVTGVIYLTMVIQTKK----SIVLKLITNV 280

  Fly   310 ILLTLAVHEAVSSSRMMRRLSLE---------NFPITDHKAWHMKWEMFLSRLNFFEFRVRPL-- 363
            :.|: ......::|.|..|::::         ..|.|......|..:..|..|     |.:|:  
  Fly   281 VWLS-PTFMTCAASFMSNRVTIQANKTAKMLTKVPRTGTGLDRMIEKFLLKNL-----RQKPILT 339

  Fly   364 --GLFEVSNEVILLFLSSMITYFTYVVQY 390
              |.|.:....:....:::.||...:||:
  Fly   340 AYGFFALDKSTLFKLFTAIFTYMVILVQF 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93cNP_732665.1 7tm_7 18..393 CDD:285581 80/419 (19%)
Gr39aNP_724330.1 7tm_7 8..372 CDD:285581 80/419 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.