DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93d and Gr98a

DIOPT Version :9

Sequence 1:NP_732666.1 Gene:Gr93d / 117470 FlyBaseID:FBgn0045468 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_651564.1 Gene:Gr98a / 43305 FlyBaseID:FBgn0039520 Length:391 Species:Drosophila melanogaster


Alignment Length:344 Identity:60/344 - (17%)
Similarity:139/344 - (40%) Gaps:56/344 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 YAFTYAEWISNRMLITEKFLHSCSLVVSIPCYLSIIHLKICHGPEVTKLVNQYLHI------FRL 121
            |.|.| :::::|...|....:..:||:.    .:||.|::..| ..:|.|::.|..      .:|
  Fly    58 YEFDY-DFLNDRFSSTIDLSNFVALVLG----HAIIVLELLWG-NCSKDVDRQLQAIHSQIKLQL 116

  Fly   122 GTLD----IRRRSQFGGGRELFLLILSVCCQIHEYVFILVIASRLCGFQHIIWWVSYTYVFIICN 182
            ||.:    :||...:..|..:...::.:...|:....:.:.|:    :..:::...::...:.|.
  Fly   117 GTSNSTDRVRRYCNWIYGSLIIRWLIFIVVTIYSNRALTINAT----YSELVFLARFSEFTLYCA 177

  Fly   183 SIMCFGFIWHLSLGVLYAELNDNLRFESGFQTAFLRKQQRIRVQKSMALFKEISSVVTSLQDIFN 247
            .|:   ||:. .|.|..:.:.|.| :.:.::...:|:....::.|..|:...:...:..|:..|.
  Fly   178 VIL---FIYQ-ELIVGGSNVLDEL-YRTRYEMWSIRRLSLQKLAKLQAIHNSLWQAIRCLECYFQ 237

  Fly   248 VHLFLSALLTLLQVLVVWYKMIIDLGFSDFRIWSF---------SLKNLIQT-----LLPVLAIQ 298
            :     :|:|||.      |..||.  |....|.:         ::::.:.|     ||.::...
  Fly   238 L-----SLITLLM------KFFIDT--SALPYWLYLSRVEHTRVAVQHYVATVECIKLLEIVVPC 289

  Fly   299 EAANQFKQTRERALDIFLVGKSKHWMKSVEIFVTHLNL----SEFRVNLLGLFNVSNELFLIIVS 359
            ....:....:.:.|.:|....:......:...:..|||    .:::.:..|:.:::.|:......
  Fly   290 YLCTRCDAMQRKFLSMFYTVTTDRRSSQLNAALRSLNLQLSQEKYKFSAGGMVDINTEMLGKFFF 354

  Fly   360 AMFCYLVFVTQCVIVYRRR 378
            .|..|:|...|..|.:|.:
  Fly   355 GMISYIVICIQFSINFRAK 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93dNP_732666.1 7tm_7 11..375 CDD:285581 59/339 (17%)
Gr98aNP_651564.1 7tm_7 13..370 CDD:285581 59/339 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.