DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93d and Gr68a

DIOPT Version :9

Sequence 1:NP_732666.1 Gene:Gr93d / 117470 FlyBaseID:FBgn0045468 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster


Alignment Length:353 Identity:65/353 - (18%)
Similarity:116/353 - (32%) Gaps:113/353 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 NRMLITEKFLHSCSLVVSIPCYLSIIHLKICHGPEVTKLVNQYL--------------------- 116
            ||.:.|...:.|.::||......:..|.:..|  ::.| :::||                     
  Fly    80 NRTIETLLCIISYTMVVLSSVQNASRHFRTLH--DIAK-IDEYLLANGFRETYSCRNLTILVTSA 141

  Fly   117 --HIFRLGTLDIRRRSQFGGGRELFLLIL-------SVCCQIHEYVFILVIASRL---------- 162
              .:..:....|..||..|..|::.||::       |....::....::.:|.|:          
  Fly   142 AGGVLAVAFYYIHYRSGIGAKRQIILLLIYFLQLLYSTLLALYLRTLMMNLAQRIGFLNQKLDTF 206

  Fly   163 ----CGFQHIIWWVSYT-YVFIIC------NSIMCFGFIWHLSLGVLYAELNDNLRFESGFQTAF 216
                ||  |:..|...: .:.::|      .:|.|..       ||       :|.|..||....
  Fly   207 NLQDCG--HMENWRELSNLIEVLCKFRYITENINCVA-------GV-------SLLFYFGFSFYT 255

  Fly   217 LRKQQRIRVQKSMALFKEIS----SVVTSLQDIFNVHLFLSALLTLLQVLVVWYKMIIDLGFSDF 277
            :..|       |...|..::    |..|.:.|...        |:.:.||.....||:.....| 
  Fly   256 VTNQ-------SYLAFATLTAGSLSSKTEVADTIG--------LSCIWVLAETITMIVICSACD- 304

  Fly   278 RIWSFSLKNLIQTLLPVLAIQEAANQFKQTRERALDIFLVGKSKHWMKSVEIFVTHLNLSEFRVN 342
                 .|.:.:.....:||                  .:.||||.:...::.|:|.....:.:..
  Fly   305 -----GLASEVNGTAQILA------------------RIYGKSKQFQNLIDKFLTKSIKQDLQFT 346

  Fly   343 LLGLFNVSNELFLIIVSAMFCYLVFVTQ 370
            ..|.|::.|.....|.||:..|||.:.|
  Fly   347 AYGFFSIDNSTLFKIFSAVTTYLVILIQ 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93dNP_732666.1 7tm_7 11..375 CDD:285581 65/353 (18%)
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 65/353 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.