DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93d and Gr59f

DIOPT Version :9

Sequence 1:NP_732666.1 Gene:Gr93d / 117470 FlyBaseID:FBgn0045468 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster


Alignment Length:351 Identity:72/351 - (20%)
Similarity:142/351 - (40%) Gaps:62/351 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SRWKWISVTLRIVPLCIYAFTYAEWISNRMLITEKFLHSCSLVVSIPCYLSIIHLK-ICH--GPE 107
            |.|:::.||.:.|.|                  :::|::....:.:....||:.|. .|.  .|:
  Fly    82 SYWEFVLVTTQRVSL------------------DRYLNAIESAIYVVHIFSIMLLTWQCRNWAPK 128

  Fly   108 -VTKLVNQYLHIFRLGTLDIRRRSQFGGGRELFLLILSVCCQI------HEYVF---ILVIASRL 162
             :|.:|...|:  |..|:|..|..:| ...:|||:.:..|..|      |::|.   ||.|.|.:
  Fly   129 LMTNIVTSDLN--RAYTIDCNRTKRF-IRLQLFLVGIFACLAIFFNIWTHKFVVYRSILSINSYV 190

  Fly   163 CGFQHIIWWVSYTYVFIICNSIMCFGFIWHLSLGVLYAELNDNLRFE-SGFQTAFLRKQQRIRVQ 226
              ..:||..:|:...:::..     |..|.      ...|.:.|..| :...:..:.:.|:||:.
  Fly   191 --MPNIISSISFAQYYLLLQ-----GIAWR------QRRLTEGLERELTHLHSPRISEVQKIRMH 242

  Fly   227 KSMALFKEISSVVTSLQDIFNVHLFLSALLTLLQVLVVWYKMIIDLGFSDFRIWSFSLKNLIQTL 291
            .:..:  :.:..|........:.||:...|....||.:.|:.|.:...:||..|...|..|...:
  Fly   243 HANLI--DFTKAVNRTFQYSILLLFVGCFLNFNLVLFLVYQGIENPSMADFTKWVCMLLWLAMHV 305

  Fly   292 LPVLAIQEAANQFKQT--RERALDIFLVGKSKHWMKSVEIFVTHLNLSEFRVN-----LLGLFNV 349
            ..|.:|.    .|.|:  .|.:..:.|:.:..:..|.::..:||. :.:.|.|     :.|:.|:
  Fly   306 GKVCSIL----HFNQSIQNEHSTCLTLLSRVSYARKDIQDTITHF-IIQMRTNVRQHVVCGVINL 365

  Fly   350 SNELFLIIVSAMFCYLVFVTQCVIVY 375
            ..:....::.|...:.:|:.|..:.|
  Fly   366 DLKFLTTLLVASADFFIFLLQYDVTY 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93dNP_732666.1 7tm_7 11..375 CDD:285581 71/349 (20%)
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 71/346 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.