DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93d and Gr43a

DIOPT Version :9

Sequence 1:NP_732666.1 Gene:Gr93d / 117470 FlyBaseID:FBgn0045468 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001286158.1 Gene:Gr43a / 35655 FlyBaseID:FBgn0041243 Length:453 Species:Drosophila melanogaster


Alignment Length:154 Identity:31/154 - (20%)
Similarity:64/154 - (41%) Gaps:14/154 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 KSMA-LFKEISSVVTSLQDIFNVHLFLSALLTLLQVLVVWYKMIIDL------GFSDFRIWSFSL 284
            ||:| ..:.:...|..|.:.|.:.:....:..||.::...|.:.::|      |:    :|...|
  Fly   298 KSLADSHESLGKCVHLLSNSFGIAVLFILVSCLLHLVATAYFLFLELLSKRDNGY----LWVQML 358

  Fly   285 ---KNLIQTLLPVLAIQEAANQFKQTRERALDIFLVGKSKHWMKSVEIFVTHLNLSEFRVNLLGL 346
               .:.::.|:.|.....||.:.::|.:...:|..........::|:.|...|.:.:...:..||
  Fly   359 WICFHFLRLLMVVEPCHLAARESRKTIQIVCEIERKVHEPILAEAVKKFWQQLLVVDADFSACGL 423

  Fly   347 FNVSNELFLIIVSAMFCYLVFVTQ 370
            ..|:..:.....||:..|||.:.|
  Fly   424 CRVNRTILTSFASAIATYLVILIQ 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93dNP_732666.1 7tm_7 11..375 CDD:285581 31/154 (20%)
Gr43aNP_001286158.1 7tm_7 10..449 CDD:285581 31/154 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.