DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93d and Gr8a

DIOPT Version :9

Sequence 1:NP_732666.1 Gene:Gr93d / 117470 FlyBaseID:FBgn0045468 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster


Alignment Length:323 Identity:64/323 - (19%)
Similarity:126/323 - (39%) Gaps:100/323 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 YLHIFRLG---TLDIRRRSQFGGGRELFLLILSVCCQIHEYVFILVIAS-----RLCGF----QH 167
            :|| |:||   |..:..||:|    :.|       |:...:::.::.|.     .|..|    ||
  Fly   106 WLH-FKLGGQKTGLVSLRSEF----QQF-------CRYLIFLYAMMAAEVAIHLGLWQFQALTQH 158

  Fly   168 -IIWWVSY------TYVFIICNSIMCFGFIWHLSL------GV-----LYAELNDNLRFES---- 210
             :::|.:|      ||       :....|:.||.|      |:     |.||.:   ||.|    
  Fly   159 MLLFWSTYEPLVWLTY-------LRNLQFVLHLELLREQLTGLEREMGLLAEYS---RFASETGR 213

  Fly   211 ---GFQTAFLRKQQRIRVQKSMALFKEISSVVTSLQDIFNVHLFLSALLTLLQVLVVWYKMIIDL 272
               ||: :|||:    |:.:...::..:..::...|..||..: |:.|||      :..::.:|.
  Fly   214 SFPGFE-SFLRR----RLVQKQRIYSHVYDMLKCFQGAFNFSI-LAVLLT------INIRIAVDC 266

  Fly   273 GFSDFRIWSFSLKN----LIQTLLPVLAIQEAANQFKQTRERALDIFLVGKSKHWMKS------- 326
            .|..:.|::..:.|    ::..||.:.|...|:...         :.:|.:..|.:.:       
  Fly   267 YFMYYSIYNNVINNDYYLIVPALLEIPAFIYASQSC---------MVVVPRIAHQLHNIVTDSGC 322

  Fly   327 ---------VEIFVTHLNLSEFRVNLLGLFNVSNELFLIIVSAMFCYLVFVTQCVIVYRRRYV 380
                     ::.|...|.....|::.|||..:...|...:..::..|:::..|.:..:...|:
  Fly   323 CSCPDLSLQIQNFSLQLLHQPIRIDCLGLTILDCSLLTRMACSVGTYMIYSIQFIPKFSNTYM 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93dNP_732666.1 7tm_7 11..375 CDD:285581 63/316 (20%)
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 62/312 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.