DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93d and Gr9a

DIOPT Version :9

Sequence 1:NP_732666.1 Gene:Gr93d / 117470 FlyBaseID:FBgn0045468 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster


Alignment Length:413 Identity:74/413 - (17%)
Similarity:147/413 - (35%) Gaps:127/413 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SVGILRFMSFYARFLSLVCFRLRKQKDNNVWLEEIWSNRSRWKWISVTLRIVPLC-----IYAFT 66
            |:.:..|::.|.:...|||.               ||.....:.:|.|..::.|.     |..:.
  Fly     2 SLWLEHFLTGYFQLCGLVCG---------------WSGSRLGRLLSSTFLVLILIELVGEIETYF 51

  Fly    67 YAEWISNRMLITEKFLHSCSLVVSIPCYLSIIHLKICHGPEVT-KLVNQYLHIFRLGTLDIRRRS 130
            ..|...|.               |:|.|.:    |:..|..:. |:::.::.:..|  .:.||  
  Fly    52 TEENPDNE---------------SVPAYFA----KVIMGVNMAYKMIHAWIALSAL--FECRR-- 93

  Fly   131 QFGGGRELFLLILSVCCQIHEYVFILVIASRLCGFQHIIWWVSYTYVFIICNSIMCFGFIWHLSL 195
                    |..:|.....:....||         ::|:|..:    :...||:.:...   ..::
  Fly    94 --------FRYLLEELPPVKATSFI---------YRHLILEI----ILFACNAFLVLS---EYTI 134

  Fly   196 GVLYAELNDNLRFESGFQTAFLR---------------KQQRIRV------QKSMAL-FKEISSV 238
            ..:|.|   |||:....|....|               :|...||      .|::.| :..::.|
  Fly   135 RGIYLE---NLRYAYSLQAVRARYLQMMVLVDRLDGKLEQLHHRVISGSSDYKTLRLDYAHLAKV 196

  Fly   239 VTSLQDIFNVHLFLSALLTLLQVLVVW--YKMIIDLGFSDFRIWSFSLKNLI--QTLLPVLAIQE 299
            ..||..:|.:.|.|..:|.|...::|.  |.|:..|......::.|.....:  .||:.:.:|..
  Fly   197 TRSLSHLFGLSLLLLNVLCLGDWIIVCNVYFMVAYLQVLPATLFLFGQVMFVVCPTLIKIWSICA 261

  Fly   300 AANQFKQTRERALDIFLVGKSKHWMK--------------SVEIFVTHLNLSEFRVNLLGLFNVS 350
            |:::            .|.||||..:              .:|.|...:.....::::.|:::::
  Fly   262 ASHR------------CVSKSKHLQQQLKDLPGQTPVERSQIEGFALQIMQDPIQIDVCGIYHLN 314

  Fly   351 NE----LFLIIVSAMFCYLVFVT 369
            .:    :|..|:.|:..:|.||:
  Fly   315 LQTLAGMFFFILEALVIFLQFVS 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93dNP_732666.1 7tm_7 11..375 CDD:285581 73/409 (18%)
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 71/404 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.