DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93d and lite-1

DIOPT Version :9

Sequence 1:NP_732666.1 Gene:Gr93d / 117470 FlyBaseID:FBgn0045468 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_509043.3 Gene:lite-1 / 180894 WormBaseID:WBGene00001803 Length:439 Species:Caenorhabditis elegans


Alignment Length:275 Identity:57/275 - (20%)
Similarity:102/275 - (37%) Gaps:72/275 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SRWKWISVTLRIVP---------LCIYAFTYAEWISNRML--ITEKFLHSCSLVVSIPCYLSIIH 99
            |:|.:|   |.||.         .|:...:||.::|...:  :...|...||::     ..||.|
 Worm   189 SKWGYI---LYIVGTPNLDTETIFCVLLDSYALFVSRAAISALAILFYQHCSVI-----RRSIKH 245

  Fly   100 L---------KICHGPEVTKLVNQYLHIFRLGTLDIRRRSQFGGGREL-----FLLILS--VCCQ 148
            |         ..|..||.:.   |.:|     ...|..:..|.|...:     |:|..|  ||..
 Worm   246 LINEMVPAEQDECPLPESSL---QKIH-----DCQISYQRIFNGKAVIEEYYSFVLFYSYGVCIP 302

  Fly   149 IHEY-VFILVIASRLCGFQ--HIIWWVSYTYVFIICNSIMCFGFIWHLSLGVLYAELNDNL---R 207
            |..: :|:.:.|..:|..:  .|:.|:....:.::..|:..|          :..|..|.|   .
 Worm   303 IFCFLMFVGMSAQSICWSEVVSIVIWIVNAILVLLLFSLPAF----------MINEDGDRLVASS 357

  Fly   208 FESGFQTAFLRKQQRIRVQKSMALFK-EISSVVTSLQDIFNVHLFLSALLTLLQVLVVWYKMIID 271
            |....:|  ..:::.:.|...|..|. :|.|...:|......::..|.||:|...::.::.:   
 Worm   358 FRMYHET--FHEERDLTVLSQMTFFTFQIHSTKLTLSACNYFYMDRSILLSLFSAILTYFLI--- 417

  Fly   272 LGFSDFRIWSFSLKN 286
                   :|.|.:||
 Worm   418 -------LWEFDIKN 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93dNP_732666.1 7tm_7 11..375 CDD:285581 57/275 (21%)
lite-1NP_509043.3 7tm_7 75..425 CDD:285581 55/273 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.