DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93d and Gr10a

DIOPT Version :9

Sequence 1:NP_732666.1 Gene:Gr93d / 117470 FlyBaseID:FBgn0045468 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster


Alignment Length:418 Identity:72/418 - (17%)
Similarity:144/418 - (34%) Gaps:135/418 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 IYAFTYA----EWISNR--------MLITEKFLHSCSLVVSIP---C------------------ 93
            :||..|.    :::..|        :||....|.|..|:|.:|   |                  
  Fly    24 VYALIYGQVVIDYVPQRALKRGVKVLLIAYGHLFSMLLIVVLPGYFCYHFRTLTDTLDRRLQLLF 88

  Fly    94 YLSIIHLKICHGPEVTKLVNQYLHIFRLGTLDIRRRS----QFGGGRE------LFLLILSVCCQ 148
            |:|..:..|.:...:...|...:|...:......:|:    :|....:      .|.:....|  
  Fly    89 YVSFTNTAIKYATVIVTYVANTVHFEAINQRCTMQRTHLEFEFKNAPQEPKRPFEFFMYFKFC-- 151

  Fly   149 IHEYVFILVIASRLCG----------------------FQHIIWWVSYT-----YVFIICNSIMC 186
                :..|::..::||                      :..::|  :||     |.:.|..|::.
  Fly   152 ----LINLMMMIQVCGIFAQYGEVGKGSVSQVRVHFAIYAFVLW--NYTENMADYCYFINGSVLK 210

  Fly   187 FGFIWHLSLGVLYAELNDNLR---------FESGFQTAFLRKQQR---------IRVQKSMALFK 233
            :...::|.||.|..|: |.||         .|...:...||::.|         .|:.:...:..
  Fly   211 YYRQFNLQLGSLRDEM-DGLRPGGMLLHHCCELSDRLEELRRRCREIHDLQRESFRMHQFQLIGL 274

  Fly   234 EISSVVTSLQDIFNVHLFLSALLTLLQVLV------VWYKMIIDLGFSDFRIWSFSLKNLIQTL- 291
            .:|:::.:|.:.:          ||..:|.      |.|.:::...::.    .|.:...|..| 
  Fly   275 MLSTLINNLTNFY----------TLFHMLAKQSLEEVSYPVVVGSVYAT----GFYIDTYIVALI 325

  Fly   292 -----LPVLAIQEAANQFKQTRERALDIFLVGKSKHWMKSVEIFVTHLNLSEFRVNLL-GLFNVS 350
                 |.:.|:.....:|.:.||  :|..|..:.:|         ..|.|..::..:| ||.::.
  Fly   326 NEHIKLELEAVALTMRRFAEPRE--MDERLTREIEH---------LSLELLNYQPPMLCGLLHLD 379

  Fly   351 NELFLIIVSAMFCYLVFVTQCVIVYRRR 378
            ..|..:|....|.|.:.:.|..:..|::
  Fly   380 RRLVYLIAVTAFSYFITLVQFDLYLRKK 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93dNP_732666.1 7tm_7 11..375 CDD:285581 71/413 (17%)
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 71/411 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.