DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93d and Gr22e

DIOPT Version :9

Sequence 1:NP_732666.1 Gene:Gr93d / 117470 FlyBaseID:FBgn0045468 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_722731.1 Gene:Gr22e / 117498 FlyBaseID:FBgn0045497 Length:389 Species:Drosophila melanogaster


Alignment Length:394 Identity:76/394 - (19%)
Similarity:144/394 - (36%) Gaps:90/394 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RWKWISVTLRIV-----PLCIYAFTYAEWISNRMLITEKFLHSCSLVVSIPCYLSII-------- 98
            |.||..:||:..     .|.::.|.|..|  .|.|...|:|.:...|::....|.::        
  Fly    10 RQKWTGLTLKGALYGSWILGVFPFAYDSW--TRTLRRSKWLIAYGFVLNAAFILLVVTNDTESET 72

  Fly    99 --HLKICHGPEVTKLVNQYLHIFRLGTLDIRRRSQF--GGGRELFL-------------LILSVC 146
              .:::.|...:.:.:|....|..|..:.|.....|  .|..|..|             ..|..|
  Fly    73 PLRMEVFHRNALAEQINGIHDIQSLSMVSIMLLRSFWKSGDIERTLNELEDLQHRYFRNYSLEEC 137

  Fly   147 CQIHEYVFILVIASRLCGFQHIIWWVS-----------YTYVFIICNSIMCFGFIWHLSLGVLYA 200
            .....:|...       ||..::..||           |:..|.|....:|.     :.|.||..
  Fly   138 ISFDRFVLYK-------GFSVVLELVSMLVLELGMSPNYSAQFFIGLGSLCL-----MLLAVLLG 190

  Fly   201 ELNDNLRFESGFQTAFLRKQQRIRVQKSMALFKEISSV------------------VTSLQDIFN 247
            ..:.:|.....::..::..::.:::...||:.:.:.|.                  :.|:.|...
  Fly   191 ASHFHLAVVFVYRYVWIVNRELLKLVNKMAIGETVESERMDLLLYLYHRLLDLGQRLASIYDYQM 255

  Fly   248 VHLFLSALLTLLQVLVVWYKMIIDLGFS---DFRIWSFSLKNLIQTLLPV---LAIQEAANQFKQ 306
            |.:.:|.|:.  .||.:::.:|..:..:   ||:|..| ::.|:..:|..   :.|.|.|.:..:
  Fly   256 VMVMVSFLIA--NVLGIYFFIIYSISLNKSLDFKILVF-VQALVINMLDFWLNVEICELAERTGR 317

  Fly   307 TRERALDIF-----LVGKSKHWMKSVEIFVTHLNLSEFRVNLLGLFNVSNELFLIIVSAMFCYLV 366
            .....|.:|     :..|.:..:....:|.:|..|   |.:..|||.|:.|:...:....|.||:
  Fly   318 QTSTILKLFNDIENIDEKLERSITDFALFCSHRRL---RFHHCGLFYVNYEMGFRMAITSFLYLL 379

  Fly   367 FVTQ 370
            |:.|
  Fly   380 FLIQ 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93dNP_732666.1 7tm_7 11..375 CDD:285581 76/394 (19%)
Gr22eNP_722731.1 7tm_7 18..388 CDD:285581 72/386 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.