DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93d and Gr36a

DIOPT Version :9

Sequence 1:NP_732666.1 Gene:Gr93d / 117470 FlyBaseID:FBgn0045468 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_724038.2 Gene:Gr36a / 117488 FlyBaseID:FBgn0045487 Length:391 Species:Drosophila melanogaster


Alignment Length:423 Identity:68/423 - (16%)
Similarity:157/423 - (37%) Gaps:97/423 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILRFMSFYARFLSLVCFRLRKQKDNNVWLEEIWSNRSRWKWISVTLRIVPLCIYAFTYAEWISNR 74
            :|:.:.:|.:.:.|:.|.:..|:...|..:       |....::.:.:: :|:...         
  Fly     8 LLKVLYYYGQIIGLINFEIDWQRGRVVAAQ-------RGILFAIAINVL-ICMVLL--------- 55

  Fly    75 MLITEKF-----------LHSCSLVVSIPCYLSIIHLKICHG-----------PEVTKLVNQYLH 117
            :.|::||           ||...::|       ::.|::..|           .::.:||...|.
  Fly    56 LQISKKFNLDVYFGRANQLHQYVIIV-------MVSLRMASGISAILNRWRQRAQLMRLVECVLR 113

  Fly   118 IFRLGTLDIRRRSQFGGGRELFLLI---LSVCCQIHEYVFILVIASRLCGFQHIIWWVSYTYVFI 179
            :| |....:::.|::.      :|:   :.|.....:....:....|| ||...:...|..::..
  Fly   114 LF-LKKPHVKQMSRWA------ILVKFSVGVVSNFLQMAISMESLDRL-GFNEFVGMASDFWMSA 170

  Fly   180 ICNSIMCFGFIWHLSLGVLYAELNDNLR---FESGF-------QTAFLRKQQRI--RVQKSMALF 232
            |.|..:...::..|.:...|..|...:|   .||..       :.||:.|...:  |:.....|.
  Fly   171 IINMAISQHYLVILFVRAYYHLLKTEVRQAIHESQMLSEIYPRRAAFMTKCCYLADRIDNIAKLQ 235

  Fly   233 KEISSVVTSLQDIFNVH---LFLSALLTLLQVLVVWYKMIIDLGFSDFRI----------W-SFS 283
            .::.|:||.|..:|.:.   ::....:..:....:.|.:.|: |..:..:          | .|.
  Fly   236 NQLQSIVTQLNQVFGIQGIMVYGGYYIFSVATTYITYSLAIN-GIEELHLSVRAAALVFSWFLFY 299

  Fly   284 LKNLIQTLLPVLAIQEAANQFKQTRER------ALDIFLVGKSKHWMKSVEIFVTHLNLSEFRVN 342
            ..:.|..|..:|.:.:...:.::..|.      |||:.|       .:|.|.....|..:..::.
  Fly   300 YTSAILNLFVMLKLFDDHKEMERILEERTLFTSALDVRL-------EQSFESIQLQLIRNPLKIE 357

  Fly   343 LLGLFNVSNELFLIIVSAMFCYLVFVTQCVIVY 375
            :|.:|.::......::.::....:|:.|..:.|
  Fly   358 VLDIFTITRSSSAAMIGSIITNSIFLIQYDMEY 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93dNP_732666.1 7tm_7 11..375 CDD:285581 67/420 (16%)
Gr36aNP_724038.2 7tm_7 9..390 CDD:285581 67/420 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.