DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93d and Gr36b

DIOPT Version :9

Sequence 1:NP_732666.1 Gene:Gr93d / 117470 FlyBaseID:FBgn0045468 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster


Alignment Length:381 Identity:71/381 - (18%)
Similarity:133/381 - (34%) Gaps:119/381 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 WISVTLRIVPLCIYAFTYAEWISNRMLITEKFLHSCSLVVSIPCYLSIIHLKICHGPEVTKLVNQ 114
            :|.:|:      ||.|| |...:|.:..:...||...:::       :..|||..|  :..::|:
  Fly    49 FILITI------IYNFT-AHGDTNLLFQSANKLHEYVIII-------MSGLKIVAG--LITVLNR 97

  Fly   115 YLH----------IFRLGTLDIRRRSQFGGG----------RELFLLILSVCC----QIHEYVFI 155
            :|.          :.||..::.:.:|....|          .||..:.|||..    ...|.:.:
  Fly    98 WLQRGQMMQLVKDVIRLYMINPQLKSMIRWGILLKAFISFAIELLQVTLSVDALDRQGTAEMMGL 162

  Fly   156 LVIASRLCGFQHIIWWVSYTYVFIICNSIMCFGFIWHLSLGVLYAELNDNLR--FESGFQTAFLR 218
            ||   :||             |..|.|..:...|:..|.:...|..:|..||  .|...:.:||:
  Fly   163 LV---KLC-------------VSFIMNLAISQHFLVILLIRAQYRIMNAKLRMVIEESRRLSFLQ 211

  Fly   219 KQQRIRVQKSMALF----------KEISSVVTSLQDIFNVHLFLSALLTLLQVLVVWYKMIIDLG 273
            .:....:.:...|.          .::.|:|..|.::|.    :..|:...:    :|..|:...
  Fly   212 LRNGAFMTRCCYLSDQLEDIGEVQSQLQSMVGQLDEVFG----MQGLMAYSE----YYLSIVGTS 268

  Fly   274 FSDFRIWSFSLKNL------------IQTLLPVLAIQEAANQFKQTRERALD------------- 313
            :..:.|:.:...||            :.||..:.|:....|..     |.||             
  Fly   269 YMSYSIYKYGPHNLKLSAKTSIIVCILITLFYLDALVNCNNML-----RVLDHHKDFLGLLEERT 328

  Fly   314 IFLVGKSKHWMKSVEIFVTHLNLSEFRVNLLGLFNVS-------------NELFLI 356
            :|.........:|.|.....|..:..::|::|:|.::             |.:|||
  Fly   329 VFASSLDIRLEESFESLQLQLARNPLKINVMGMFPITRGSTAAMCASVIVNSIFLI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93dNP_732666.1 7tm_7 11..375 CDD:285581 71/381 (19%)
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 71/381 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.