DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr93d and Gr59d

DIOPT Version :9

Sequence 1:NP_732666.1 Gene:Gr93d / 117470 FlyBaseID:FBgn0045468 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_611758.2 Gene:Gr59d / 117343 FlyBaseID:FBgn0041236 Length:390 Species:Drosophila melanogaster


Alignment Length:311 Identity:62/311 - (19%)
Similarity:121/311 - (38%) Gaps:95/311 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 VNQYLHIFRLGTLDIRRRSQFGGGRELFLLILSVCCQ----IHEYVFILVIASR-LCGFQHII-- 169
            |:.:|.||.|......|:|           :::|..:    :|||||:::...| :|.|..::  
  Fly    44 VSTHLLIFALLLYQTMRKS-----------VVNVMWKYANSLHEYVFLVIAGFRVVCVFLELVSR 97

  Fly   170 WWVSYTYVFIICNSIMCFGFIWHLSLGVLYAELNDNLRF-ESGFQTAF--LRKQQRIRVQKSMAL 231
            |....|:|.:. ||..           .||....|.::: .....:.|  :...:.:.:..::|:
  Fly    98 WSQRRTFVRLF-NSFR-----------RLYQRNPDIIQYCRRSIVSKFFCVTMTETLHIIVTLAM 150

  Fly   232 FKEISSVVTSLQDIFNVHLFLSALLTLLQVLVVWYKMIIDLGFSDFRIWSFSLKNLI---QTLLP 293
            .:...|:..:|:    :...|| |..::.|::..|.:........:.:.:..|:.::   |:|:|
  Fly   151 MRNRLSIALALR----IWAVLS-LTAIINVIITQYYVATACVRGRYALLNKDLQAIVTESQSLVP 210

  Fly   294 ------VLAIQEAANQFKQTRERALDIFLVGKSKHWMKSVEIFVTHLNLS------------EFR 340
                  |......|::.::..:...|:         .:.||      |||            .:.
  Fly   211 NGGGVFVTKCCYLADRLERIAKSQSDL---------QELVE------NLSTAYEGEVVCLVITYY 260

  Fly   341 VNLLG----LFNVS------NELFLIIVSAMFCYLVFVTQCVIVYRRRYVI 381
            :|:||    ||::|      |.|           ||.:|.|.|||...||:
  Fly   261 LNMLGTSYLLFSISKYGNFGNNL-----------LVIITLCGIVYFVFYVV 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr93dNP_732666.1 7tm_7 11..375 CDD:285581 58/303 (19%)
Gr59dNP_611758.2 7tm_7 9..389 CDD:285581 62/311 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.