DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl11 and ADGRG1

DIOPT Version :9

Sequence 1:NP_731479.3 Gene:mthl11 / 117467 FlyBaseID:FBgn0045443 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_005256294.1 Gene:ADGRG1 / 9289 HGNCID:4512 Length:698 Species:Homo sapiens


Alignment Length:303 Identity:69/303 - (22%)
Similarity:107/303 - (35%) Gaps:75/303 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 ECVRKSRLSNASIPVKFSSVFFMVITIAAYLW----LPKFRSLHGKCCNLYFICLAITFLLNVIS 278
            :.|.|..||..|......|....::||||||.    ||..|....     |.|.:.:..||.|..
Human   401 DAVHKHYLSLLSYVGCVVSALACLVTIAAYLCSRVPLPCRRKPRD-----YTIKVHMNLLLAVFL 460

  Fly   279 LFGIFELKTPICYLTGYAG--------YFTVMATFLWLSVISFDVWRRFAMRKFQVFYKNKRSSF 335
            |...|.|..|:......||        :|:::....|:.:..::::|...    :||........
Human   461 LDTSFLLSEPVALTGSEAGCRASAIFLHFSLLTCLSWMGLEGYNLYRLVV----EVFGTYVPGYL 521

  Fly   336 FNYNIIVWSSAGLLTCIIFLVDQFVETNLDNPYNPAV--------GVF---SCWI-------FTN 382
            ...:.:.|.....|..::.|||      :|| |.|.:        ||.   .|||       .||
Human   522 LKLSAMGWGFPIFLVTLVALVD------VDN-YGPIILAVHRTPEGVIYPSMCWIRDSLVSYITN 579

  Fly   383 -G-WSATFYF-YAPLAILIILNCASFFLTTRYIYVENKQNQKVLNNSEPQKLSRNHANYRIYFRL 444
             | :|..|.| .|.||.:::                    |.:......||.|    :......|
Human   580 LGLFSLVFLFNMAMLATMVV--------------------QILRLRPHTQKWS----HVLTLLGL 620

  Fly   445 FIIMGGSWFLEIIAFICEMENMWKPLIILNDYINCSQGIIIFV 487
            .:::|..|.|...:|......:  .::.|...|...||.:||:
Human   621 SLVLGLPWALIFFSFASGTFQL--VVLYLFSIITSFQGFLIFI 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl11NP_731479.3 Methuselah_N 26..204 CDD:310923
7tmB3_Methuselah-like 236..504 CDD:320167 64/285 (22%)
TM helix 2 258..280 CDD:320167 5/21 (24%)
TM helix 3 291..318 CDD:320167 4/34 (12%)
TM helix 4 335..355 CDD:320167 2/19 (11%)
TM helix 5 383..412 CDD:320167 7/30 (23%)
TM helix 6 433..460 CDD:320167 4/26 (15%)
TM helix 7 468..493 CDD:320167 6/20 (30%)
ADGRG1XP_005256294.1 GPS 349..393 CDD:280071
7tm_4 408..659 CDD:304433 65/292 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.