| Sequence 1: | NP_731479.3 | Gene: | mthl11 / 117467 | FlyBaseID: | FBgn0045443 | Length: | 532 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_021333746.1 | Gene: | adgre10 / 569655 | ZFINID: | ZDB-GENE-090313-152 | Length: | 690 | Species: | Danio rerio |
| Alignment Length: | 268 | Identity: | 60/268 - (22%) |
|---|---|---|---|
| Similarity: | 105/268 - (39%) | Gaps: | 49/268 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 237 VFF--MVITIAAYLWLPKFRSLHGKCCNLYFICLAITFLLNVISLF-GIFELKTPICYLTGYAGY 298
Fly 299 FTVMATFLWL---SVISFDVWRRFAM---RKFQVFYKNKRSSFFNYNIIVWSSAGLLTCIIFLVD 357
Fly 358 QFVETNLDNPYNP-AVGVFSCWI-FTNG--WSATFYFYAPLAILIILNCASFFLTTRYIYVENKQ 418
Fly 419 NQKVLNNSEPQKLSRNHANYRIYFRLFIIMGGSWFLEIIAFICEMENMWKPLIILNDYINCSQGI 483
Fly 484 IIFVATFC 491 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| mthl11 | NP_731479.3 | Methuselah_N | 26..204 | CDD:310923 | |
| 7tmB3_Methuselah-like | 236..504 | CDD:320167 | 60/268 (22%) | ||
| TM helix 2 | 258..280 | CDD:320167 | 4/21 (19%) | ||
| TM helix 3 | 291..318 | CDD:320167 | 5/29 (17%) | ||
| TM helix 4 | 335..355 | CDD:320167 | 5/19 (26%) | ||
| TM helix 5 | 383..412 | CDD:320167 | 8/30 (27%) | ||
| TM helix 6 | 433..460 | CDD:320167 | 6/26 (23%) | ||
| TM helix 7 | 468..493 | CDD:320167 | 7/24 (29%) | ||
| adgre10 | XP_021333746.1 | GPS | 360..406 | CDD:197639 | |
| 7tm_GPCRs | 413..672 | CDD:333717 | 60/268 (22%) | ||
| TM helix 1 | 413..437 | CDD:320095 | 3/10 (30%) | ||
| TM helix 2 | 446..467 | CDD:320095 | 4/22 (18%) | ||
| TM helix 3 | 481..503 | CDD:320095 | 3/21 (14%) | ||
| TM helix 4 | 527..543 | CDD:320095 | 4/16 (25%) | ||
| TM helix 5 | 561..584 | CDD:320095 | 7/26 (27%) | ||
| TM helix 6 | 608..631 | CDD:320095 | 5/22 (23%) | ||
| TM helix 7 | 635..660 | CDD:320095 | 8/26 (31%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG4193 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||